SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0180810 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0180810
Domain Number 1 Region: 179-261
Classification Level Classification E-value
Superfamily DEATH domain 6.73e-18
Family DEATH domain, DD 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0180810   Gene: FBgn0154307   Transcript: FBtr0182318
Sequence length 274
Comment type=protein; loc=scaffold_4:complement(6954578..6954739,6954804..6955466); ID=FBpp0180810; name=Dper\GL16703-PA; parent=FBgn0154307,FBtr0182318; dbxref=FlyBase:FBpp0180810,FlyBase_Annotation_IDs:GL16703-PA,GB_protein:EDW36398,REFSEQ:XP_002018559,FlyMine:FBpp0180810; MD5=ee07abf76cb5e27ce9b1fd2367b2c5ca; length=274; release=r1.3; species=Dper;
Sequence
MPKLKNLLPNIFGGSKEAPSMQSEGRLETDAAPVDDSGADNNNSGALALPSINTPTASAD
LTESVLRELSDPNYNSMDVVQSANIPGTGGDLSTVNTNNTMNVHSAQQQVVMNFSNASNL
HFGSVYNFNKNLSASSSRKSSTGTIDEVAVSPDGKRSNGTRKTVSIVAMMQSQDEPDPRL
LDAVATHLGEGWKQVMRDLGHSEGQIDQAIIDHQMHGNIKEVIYQLLLQWVRSSESGVAT
VGRLTTLLWESQHRDCVQRLKLVWKALEKRKTNS
Download sequence
Identical sequences B4GIY0
FBpp0180810 XP_002018559.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]