SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0180863 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0180863
Domain Number 1 Region: 16-130
Classification Level Classification E-value
Superfamily L domain-like 4.08e-26
Family Internalin LRR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0180863   Gene: FBgn0154360   Transcript: FBtr0182371
Sequence length 471
Comment type=protein; loc=scaffold_82:complement(221154..221267,221331..221424,221488..221741,221841..221939,222643..222717,222944..223069,223223..223556,223636..223809,226232..226297,226800..226879); ID=FBpp0180863; name=Dper\GL16756-PA; parent=FBgn0154360,FBtr0182371; dbxref=FlyBase:FBpp0180863,FlyBase_Annotation_IDs:GL16756-PA,GB_protein:EDW39458,REFSEQ:XP_002028283,FlyMine:FBpp0180863; MD5=671085f406533652da856d178bd1d36e; length=471; release=r1.3; species=Dper;
Sequence
MTRLTEEMVIARSKQSDLGLITKLNCWGSDLTDVSIIKRMRGVEVLALSVNKISTLAHFE
DCSKLQELYLRKNHIQDINEIAYLQNLPALRNLWLEENPFCDQAGANYRAIVLRALPNLK
KLDNVEVTQEEVDDALRRGGSVGGGGGGGGGGSGSVPEDEVYEDAYEVRQQQRTSPQHSY
PTHSPPPQQQQQYHPQTQQQPQQQPQQQRQSSSPIMREPLLLASPPGNHSCEGTITHSAS
DLGGSQVLPVHGSKPPTPTKEPVHPPSPMYNTLTKEQRTSYQQYDRSPGSDQESSPNAGY
REVRPAPIPPSISAHSMKEYYQSDRPTYPAHYRHSQTDLTEWEEHQQHQVPQVHHNPYGS
QMLNHPQRRSVGPESGDRFTGYRNGSARENGGDWDPEERPRSRRPEGRYSDSTNNVSASV
ANHYSGYHRRPINRSSNLLSATLCLVKELDYASLEVLEHAVRCRIDELATE
Download sequence
Identical sequences B4HBQ4
FBpp0180863 XP_002028283.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]