SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0181002 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0181002
Domain Number 1 Region: 178-311
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.28e-17
Family Toll/Interleukin receptor TIR domain 0.0042
Further Details:      
 
Domain Number 2 Region: 17-107
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000412
Family DEATH domain, DD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0181002   Gene: FBgn0154499   Transcript: FBtr0182510
Sequence length 474
Comment type=protein; loc=scaffold_4:complement(4582793..4583237,4583303..4583489,4583560..4583728,4583798..4584093,4584171..4584498); ID=FBpp0181002; name=Dper\GL16895-PA; parent=FBgn0154499,FBtr0182510; dbxref=FlyBase:FBpp0181002,FlyBase_Annotation_IDs:GL16895-PA,GB_protein:EDW36039,REFSEQ:XP_002018200,FlyMine:FBpp0181002; MD5=8bef85f32cc0ddc37267135f6049580b; length=474; release=r1.3; species=Dper;
Sequence
MVVPEEPGSGGFNQTPLSELSADTRNQLARMLNRKKVLHSEEGYERDWRGIAALAHQRGF
VEEYANNPMDLVLSSWSQRNPETAKVGHLEHFLGIIDRWDVCDDIQENLTKDTRRYNVRQ
EQQQALVEAHRPPTVIETNNNKSSTNNTNTNNITVGQSVQILSDDDQRCVQMGQPLPRYN
ACVLYAEADIDHATEIMNHLESERYNLKLFLRHRDMLMGVPFEHVQLSHFMATRCNHLIV
VLTEEFLRSPENTYLVNFTQKIQIENHTRKIIPILYKPDMHIPQTLGIYTHIKYAGDSKL
YNFWDKLARSLHDLDAFSIYSTRQLKTPSPTEEVPPQRVTTPNIRIQINDKDVTDLPNYS
YKAIEEDATIVSMTGDTSAPLPEPKPKRKDKLFGKIKISFGKTPRNLNGTTGKPLRHAHS
ISTINVTERERTLSASSSNISTTSESKKSSIKWQPSILKKVLFSRSSSKLQTPG
Download sequence
Identical sequences B4GHR9
FBpp0181002 XP_002018200.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]