SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0181048 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0181048
Domain Number 1 Region: 898-992
Classification Level Classification E-value
Superfamily DEATH domain 3.36e-17
Family DEATH domain, DD 0.00047
Further Details:      
 
Domain Number 2 Region: 190-280
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000226
Family I set domains 0.033
Further Details:      
 
Domain Number 3 Region: 279-327
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000471
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 338-364
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000209
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  FBpp0181048
Domain Number - Region: 84-185
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00131
Family I set domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0181048   Gene: FBgn0154545   Transcript: FBtr0182556
Sequence length 1000
Comment type=protein; loc=scaffold_4:complement(3964769..3966087,3966146..3966219,3966282..3966474,3966560..3966688,3968889..3969170,3971926..3972096,3972165..3972446,3972573..3973125); ID=FBpp0181048; name=Dper\GL16941-PA; parent=FBgn0154545,FBtr0182556; dbxref=FlyBase:FBpp0181048,FlyBase_Annotation_IDs:GL16941-PA,GB_protein:EDW35945,REFSEQ:XP_002018106,FlyMine:FBpp0181048; MD5=d131d3901be09be2adc65b1eecd179c3; length=1000; release=r1.3; species=Dper;
Sequence
MSDSMEEAGMSIDPLTAMAPFANAPLVTEDSAPHRTNIELLSNSSEDENGRIGLGSSSAA
AAGTLLEEFNGGKLSPAEASNTLPIFLSEPESVFVVKNRPAVLKCKASHSLQVIFKCSGS
SQPPPSTHDKHVDPHTGVHMEEVTATIHRDLVDEYFGKGPFKCECHAWSSRGVVKSQAAT
VHIAYIRKTFGQSPTSLRLELGSRAELHCEPPGGFPEPKLSWYKSNAVITSDSEPGLAVA
GGTLTFRPVALQHMANYSCSAENIAGKRVSDSAVLIVYVNGGWSTWSPWRECKCAGKPSQ
GRKRSRTCTNPMPLNGGAQCPGPQIQKSADCAACPVARWSAWSDWSICSAECIQVRRRKC
LTQTSDGDEAGDLLLAGVGMAALSSISGSATLLDATATDGGSGYGKSLCAGKDTQTAECR
GEQCHIGKDDFDWTLYLGLAFITAVFFAFGAALICCARRGMRANPHYNMARSVMDADYMP
GVVEKKEMRMHIEASNLGYDYVNPGHRYMPGEHIVGMGMGCGGVTEHHYDVPNLAANYTN
PIDDLSADYLSETGESSTADTSNSTFDMNAKLSLLNASKSSSYELLGSTGGQLRLYGGEL
LLFVPEHAIGKNLKKHVSLLLLSDECSRVSCATESSILCSSVVHSAPRNYSFVKPVILKI
PHCLVAPEQWHVHIYHADSEHDELNVSWRRAVSVGEETINTPMFVQLETTHVYIMTEQLG
HFAIVAEPRIQQPAIKMKLLVFSQHTPPSSANCSLRIYVVKDLPNSKDICVSVECKLGGS
FLGESQVFAFELNSRNLNIRVRCAEMEAGAPYEHAIPYHHILSNNSILHCEFSMRRLDQS
TLCVDFGQGGKDDSDYCTFNIPTHSMSGSAEELASTTNTTISIDRQGNYVNESCVMDFVQ
LPHMTKRLICAALDPPRADERDWRLLAKKLNTDRYIAYFATKPSPTEQILNLWECRANSC
STNSSTSVSHTIMALLLTLKEMGRQDVLDIIVETIGPLWI
Download sequence
Identical sequences B4GHH5
XP_002018106.1.64850 FBpp0181048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]