SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0182497 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0182497
Domain Number 1 Region: 536-922
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.61e-128
Family Ankyrin repeat 0.00000000335
Further Details:      
 
Domain Number 2 Region: 178-547
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.23e-106
Family Ankyrin repeat 0.000000215
Further Details:      
 
Domain Number 3 Region: 1574-1656
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000228
Family DEATH domain, DD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0182497   Gene: FBgn0155991   Transcript: FBtr0184005
Sequence length 1700
Comment type=protein; loc=scaffold_51:join(1..414,3267..3374,3434..4547,4701..4804,4864..5808,7793..8129,8379..8472,8541..8765,8828..10589); ID=FBpp0182497; name=Dper\GL18390-PA; parent=FBgn0155991,FBtr0184005; dbxref=FlyBase:FBpp0182497,FlyBase_Annotation_IDs:GL18390-PA,GB_protein:EDW36513,REFSEQ:XP_002027558,FlyMine:FBpp0182497; MD5=57ac2b6732973d162c695df72309de67; length=1700; release=r1.3; species=Dper;
Sequence
TPDLRVLGVSGSRRTYTESLSESRDQLDGSKERQQRIGAMLGKSFRIAGQIVDSFRKRLL
KEYLPCLTTRTKWHGPPTNPIQLGDVVVLADETSPKVQWRKGVIMDLRVAKDGIARSAVI
RTASGLLTRPIVKLAKLDNDSTISFLRAARSGDLTKLLDFIESGEISDINSCNANGLNAL
HLAAKDGYVDICSELLKRGIKVDNATKKGNTALHIASLAGQQHVIKQLIQSNANVNVQSL
NGFTPLYMAAQENHDNCCRLLLAKGANPSLATEDGFTPLAVAMQQGHDKVVAVLLESDVR
GKVRLPALHIAAKKNDVSAATLLLQHDHNADIVSKSGFTPLHIAAHYGNVDIATLLLDHG
ADVNYIAKHNISPLHVACKWGKSTVCRLLLSHGARIDGPTRDGLTPLHCASRSGHVEVIE
LLLRHNAPILSKTKNGLSALHMSAQGEHDEAARLLLEHKAPVDEVTVDYLTALHVAAHCG
HVRVAKLLLDYGANPNSRALNGFTPLHIACKKNRIKVAELLIKHGATISATTESGLTPLH
VASFMGCMNIVIYLLQHDASPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDAVARE
GQTPLHVASRLGNIDIIMLMLQHGAEINAKTKDKYTALHIAAKEGQEEVSLALLESGARL
DEVTQKGFTPLHLASKYGHQKVVALLLEKGASIDCQGKNDVTPLHVASHYDHQPVVMVLL
ENGASPKICARNGHSAVHIVAKKNNVEMAQHLIQHGADVGAISKSGFSPLHLAAQEGHLP
MVELLLENGATSAAAKNGLTPLHLASQEGHVPVAQILLENGASISERTKNGYTPLHIAAH
YGQINLVKYLLENDADIEMSTNIGYTPLHQAAQQGHIMIISLLLRHKANPDALTNNGKTA
LNIASNLGYVTAVETLKVVTQTSITNMSIGMVGEKYKVVSPELMHETLLSDSEDEGGDEL
LDHNQYKYMATDDLKANYGHDHDHQNFDTTNPENDQMDISVGHPLEKEMIKHEEQELSAS
TIGRQSDNSLIVRPPVHLGFLVSFLVDARGGSMRGYRHSGVRIIVPPKACSEPTRITCRY
VKPQRVANPPPLMEGEALVSRILEMSPVEGKFLSPITLEVPHFGSLRENEREIIILRSDN
GESWREHSLYENEEHILDALHDAIDADVNPLEELHTSRIVRIVTQNVPHFFAVVSRVRQE
VHAIGPDGGTVSSIAVPQVQAIFPPHALTKKIRVGLQAQPVDLVGCSKLLGQGVAVSPVV
TVEPRRRKFHKAITLSIPAPKACTKGMVNASYGNGNANAPTLRLLCSITGGQTRAAWEDV
TGSTPLAFVKDSVTFTTTVSARFWLMDCRNIADAGRMATELYTYMTQVPFVVKFVIFAKR
ISYTEAKFSVFCMTDDKEDKTLEQQEYFTEIAKSRCIEVLQDQTIYIEFSGNLVPVLKSG
EQLNTKFQAFRENRLSFIVHIKDPELPQSRICFMSEPKVGPGEAPQIPICALNVSVHDAK
LSTHNENGLLESFDHGNNLYKEINRNDLINTEMKARATETAAIDNQNQNVIIDQPKNLKP
NRAGSSKVIHHADISLLNICSLIGSDWPQLVKELGVPETDIDLFKAENIGDLTPEQRILM
LQFRLQEEQEGISAAKILSQALNRIGRADIIDQCIFNMEPVTDKSELDLTTVKKNESLTL
TPTDSSDATRREDGRVNKRS
Download sequence
Identical sequences B4H9M9
XP_002027558.1.64850 FBpp0182497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]