SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0185241 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0185241
Domain Number 1 Region: 33-195
Classification Level Classification E-value
Superfamily L domain-like 1.84e-38
Family L domain 0.00013
Further Details:      
 
Domain Number 2 Region: 319-466
Classification Level Classification E-value
Superfamily L domain-like 9.64e-36
Family L domain 0.00027
Further Details:      
 
Domain Number 3 Region: 464-577
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000382
Family Fibronectin type III 0.006
Further Details:      
 
Domain Number 4 Region: 701-797
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000379
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number 5 Region: 592-656,707-731
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000155
Family Fibronectin type III 0.013
Further Details:      
 
Domain Number 6 Region: 176-313
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000103
Family Growth factor receptor domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0185241   Gene: FBgn0158728   Transcript: FBtr0186749
Sequence length 949
Comment type=protein; loc=scaffold_16:complement(442060..443487,443680..443983,444046..444402,444487..444612,444680..444840,444910..444990,445051..445443); ID=FBpp0185241; name=Dper\GL21134-PA; parent=FBgn0158728,FBtr0186749; dbxref=FlyBase:FBpp0185241,FlyBase_Annotation_IDs:GL21134-PA,GB_protein:EDW27241,REFSEQ:XP_002023113,FlyMine:FBpp0185241; MD5=b5d5a85c7ad9821777958e0bcf6e9c63; length=949; release=r1.3; species=Dper;
Sequence
MGFGHNVVGLILLVLTVCCGVGVGAVAAAAGPEHECTSIDIRNECSKMHLLDNCTVVTGY
VMITLIATHPYCNYSTYKFPKLKEITEFMIFTEVRGLTRVDEMFPNLTVIRGRRLFLNYA
LGVTNMPDLEYLEFPSLVAIQRGHVYIGNCPKLCQHEGVNWDLLTLSRGENHIMVGSSRC
NTSVCRGCDSSYCWSTFKCQRSQNDNVAHYKVKVDYCHDECLGGCHQNGSATACQICRGI
SDEGVCVKRCPERKVSPWKQYQRCYTQEECVKKHNHFTFVSQCVGFCPSGYRANEKNECM
RCGPQEACISVCSPEPSSNAITIYNLGDAEELRGCQIVNGSLIITIRNQVNETQLVQSLT
SIREIRGHLKVYRSSQLRSLKFLSKLERIHGDPLENRHYALILYDNKQLGELWKPESKLE
FVEGGMFMHRNNKLCNKHMKEFQGVVTHDRSLDSLQTSDQEVLCSPSKLLLFVQKRTHRT
VKLSWPKSQTSHELELVHRPLPPGVFYPEESELEAPVCIRINWQRRLLFPDELSENGTHY
YFVLDKLEPDTRYACLLRTFGGDLSQEARSDLLYVQTERDIPQPPLLELVRKTDSSLTVR
MKSHNHHHYMLTVYELEDDEAYIDSRDYCHQPSYLWQDMDGGQWRAFEDYDDCCAHQAEQ
ADDHYFIAEMRKQYRCSLDNQDQCHDLDQEHAPLLRVQLPFNTSEYELRQLQRYRLYSLQ
LQACSDLGCSSHTTLNERTNYTLGADLLTQLTACRVPDSNKYILRFAEPVQPNGQVVSYV
VHYRNNLSDSHMSCLTRLQHATAEYVYAAQLNVTFSECAVRVHSLAGDVLTPYVAITWCS
EQEQILPHSRPTKQLNTSLGVSQVKTASSHSRGISIFLVCFLFGCSLSLMWIFYKRRCWR
KLPGLRRYVPVVQWLRERHHTEDREILVDGFETVRFQNNNNSSPDDYRM
Download sequence
Identical sequences B4GXD0
FBpp0185241 XP_002023113.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]