SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0186785 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0186785
Domain Number 1 Region: 86-273
Classification Level Classification E-value
Superfamily L domain-like 1.06e-38
Family Ngr ectodomain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0186785   Gene: FBgn0160269   Transcript: FBtr0188293
Sequence length 447
Comment type=protein; loc=scaffold_20:complement(1601955..1602109,1602173..1602346,1602417..1602699,1602874..1603149,1603212..1603462,1603527..1603726,1604293..1604297); ID=FBpp0186785; name=Dper\GL22678-PA; parent=FBgn0160269,FBtr0188293; dbxref=FlyBase:FBpp0186785,FlyBase_Annotation_IDs:GL22678-PA,GB_protein:EDW29591,REFSEQ:XP_002024193,FlyMine:FBpp0186785; MD5=0955c82cbb885e3ab391476e73b6d79a; length=447; release=r1.3; species=Dper;
Sequence
MTISHTFAAPAAAEAQQNPSNSSVDDYIYDDDDYSEETASKGSPETAENRLMPFTSSTTT
TTTFRPTFNIPRRSNLVLEPSCPRQCRCVEDKYIQCSNAHLTHVPLDIPRTAAIIDLSYN
VIAELRPEDFANLSRLVEINLSHNLLSHLDKEAFHGLERLRRLRLANNRLTKIEPDTFVG
ATDLELLDLSNNSITQRLEGSFLNQPGLIEFSCSNCSWTELPEQTFVNMSALQTLRLNNN
DFEQKINTRAFAPLKNIIKLKLPELDQANIEELCNLLKSIDNISFRHFDVSCFELVLGTS
FNESLIQATDPPFKRVTGLPTAATATARPAATPAPTRTANRNRNKMANSTAAAIEVVKAG
IGAVTESSGVIVETTTDKEKPYQVPISQETINTLLICIMVLAVIGIVIGLICRKDVGGIK
TKCCRTSKPEPKDQVHPTEEIPLNKLA
Download sequence
Identical sequences B4H014
FBpp0186785 XP_002024193.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]