SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0187157 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0187157
Domain Number 1 Region: 187-491
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-67
Family Protein kinases, catalytic subunit 0.0000603
Further Details:      
 
Domain Number 2 Region: 23-123
Classification Level Classification E-value
Superfamily DEATH domain 6.02e-28
Family DEATH domain, DD 0.00000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0187157   Gene: FBgn0160640   Transcript: FBtr0188665
Sequence length 499
Comment type=protein; loc=scaffold_0:complement(10757859..10758390,10758459..10759124,10759184..10759485); ID=FBpp0187157; name=Dper\GL23050-PA; parent=FBgn0160640,FBtr0188665; dbxref=FlyBase:FBpp0187157,FlyBase_Annotation_IDs:GL23050-PA,GB_protein:EDW25060,REFSEQ:XP_002014074,FlyMine:FBpp0187157; MD5=ec0a1fa152ea93451605ad31ac7792f4; length=499; release=r1.3; species=Dper;
Sequence
MSGSETAEAQGTANRTRSRSHQDDTLLIRLLPVVARHQLCVHLDSLDVWQQLATAVKLYP
EQVEQIRHQKDRGRSPANEFMNIWGGQYNHTVQSLFALFKKLKLHHAMRMIKDYVNEDLH
KYIPRSVPTISDLRAPPDSNSKIDNGPPFPSSSGVSNSNNNRTTTTMSEEIPSLESLGNI
HISTVQRAAESLLKIDYSELERATDSWCPENRLGQGGFGEVYKGEWKQLDVAIKVMNYRS
PNIDKNQVELQQSYNELKYLNTIRHDNILALYGYSINGDKPCLVYQLMKGGSLENRLRAH
KLQQPLPALTWMQRFSICHGTAKGIYFLHTARSTPLIHGDIKPANILLDQCLQPKIGDFG
LAREGPKSINAVMQVKKVFGTRIYLPPEFRNSKQLSTGVDVYSFGIVLLEVFTGRQVTDR
LPKNDQHQDLLHYVKQNWAQSQQNRLELLDKHIPKAVGDELDMCLCAIEAGLQCTALETQ
DRPSMNGVLNRFKPFRIDF
Download sequence
Identical sequences B4G3V5
FBpp0187157 XP_002014074.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]