SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0187323 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0187323
Domain Number 1 Region: 600-690
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000145
Family DEATH domain, DD 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0187323   Gene: FBgn0160806   Transcript: FBtr0188831
Sequence length 718
Comment type=protein; loc=scaffold_0:complement(8124072..8124873,8124935..8125237,8125298..8125584,8125642..8126325,8126397..8126477); ID=FBpp0187323; name=Dper\GL23216-PA; parent=FBgn0160806,FBtr0188831; dbxref=FlyBase:FBpp0187323,FlyBase_Annotation_IDs:GL23216-PA,GB_protein:EDW24764,REFSEQ:XP_002013778,FlyMine:FBpp0187323; MD5=c9f71f5079c84be2cd9d4ff65c7e2709; length=718; release=r1.3; species=Dper;
Sequence
MSTTAEATVKPPPMKSANYFALQTAFENALEKAIKDNSVEMLVKEYNSYTANSEHDKRLP
MDHAFRVLLMKRLKDDVKRIGDLVRLSVEATRAEIVSNTIPVVLLIDTFDVVTLDRCQEI
FKFVEELVDVWKEEIFFASCKNNILRMCNDLLRRLSRTQNTVFCGRILLFLSKFFPFSER
SGLNIVSEFNLDNLTEYGLDSRDHDDTDNKELEDTAEDIPLKIDYDLYCKFWSLQDFFRN
PNQCYGKAQWKMFHMHADNILQSFASFKLEDVRPSNSENGSEADQAMDVDDDIVDAAVAS
TVSKANHFFAKFLTNPKLLALQLSDSNFRRAVLVQFLILFQYLQVSVKFKIDTYTLTTEQ
ADFIKDTEPRVYKLLEETPPYGRRFARTVHHMLVREEMWNNWKNEGCKEFKKPEDPPSND
EDNKPPPAKRPKRPLGDSLRDAARNGKFFLGNENLTRLWNYSPDNLQACKSEQRNFLPLL
ETYLETPHDKIDPAFEWRALRLLARQTPHFFTSPSQPSSKISDYLEQVRKRLVRDREPKQ
SAPVSSNASEQNNGLAAKSTPAENEQDAGMALQEAEPEQDLEVEDTDPVVEEVEENPGHE
KSLMVTAKHIEEVAPLIGEPWMKVGKKIGFTNDELLFYQMEHPTASVACSKMLCTWISED
DDATLENWAYMLEGLEMNQAADAVKAIIEKEKSGSSGTTATVEQSQLEDDNDVEVLSD
Download sequence
Identical sequences B4G598
XP_002013778.1.64850 FBpp0187323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]