SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0188118 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0188118
Domain Number 1 Region: 143-239
Classification Level Classification E-value
Superfamily DEATH domain 1.38e-19
Family DEATH domain, DD 0.004
Further Details:      
 
Domain Number 2 Region: 17-93
Classification Level Classification E-value
Superfamily DEATH domain 0.00000108
Family DEATH effector domain, DED 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0188118   Gene: FBgn0161601   Transcript: FBtr0189626
Sequence length 241
Comment type=protein; loc=scaffold_0:3937285..3938010; ID=FBpp0188118; name=Dper\GL24011-PA; parent=FBgn0161601,FBtr0189626; dbxref=FlyBase:FBpp0188118,FlyBase_Annotation_IDs:GL24011-PA,GB_protein:EDW24207,REFSEQ:XP_002013221,FlyMine:FBpp0188118; MD5=e5cd0a9e0edc6ae186081f78c6a95683; length=241; release=r1.3; species=Dper;
Sequence
MPGNHWYDILKKIACEGSSDIDQLKGIFEKELSKRKFDSIRNIEDLIDVLERADMLSLDN
VEPLRKMSSHNPKLIEALDRYGTLVSAPREPINIYQEERLAEELRQHLRISQAFQIVSAP
RVAPPAFIRAAAPTPPPPQQNYVTPAAFTDRKRTAVFNKISEELGRFWRIFGRKAGIGEG
TMDDIEERYPRDLKSRILHLLKLIEEDDCHDPRQFLMRLCRALTECGRNDIKRKVEQIMS
H
Download sequence
Identical sequences B4G312
XP_002013221.1.64850 FBpp0188118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]