SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0189719 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0189719
Domain Number 1 Region: 430-574
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.92e-32
Family Toll/Interleukin receptor TIR domain 0.00069
Further Details:      
 
Domain Number 2 Region: 36-119,225-372
Classification Level Classification E-value
Superfamily L domain-like 6.38e-20
Family Ngr ectodomain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0189719   Gene: FBgn0163196   Transcript: FBtr0191227
Sequence length 591
Comment type=protein; loc=scaffold_5:complement(4744553..4746328); ID=FBpp0189719; name=Dper\GL25612-PA; parent=FBgn0163196,FBtr0191227; dbxref=FlyBase:FBpp0189719,FlyBase_Annotation_IDs:GL25612-PA,GB_protein:EDW37292,REFSEQ:XP_002019096,FlyMine:FBpp0189719; MD5=b53dd41b9d98b437f23d2eb0b4158f4d; length=591; release=r1.3; species=Dper;
Sequence
MCKENSFYCLFTRGVHGRRCPEVCECRYMRYEREFTIDCSERNLNEIPPLPRPIAGSPTL
NFRGNNLRHLPSQSTPGYNHLMRLDVSDNKLHNLEISQLPVHLEHLNIGFNNISTLDKKL
VDYMAKNISLNSFGNLFFPYCDEKPSSDYYNFILTFQERSHSQIHNFLIERGRNMHLTDD
PWHCFWKMTTFLLILRGRVNHARKYAAALEFSHFDGECPDDCICLRNYYSMEFIVDCSGE
DLSEIPPLPIPMYGPTTLLFQNNKLRVLPNDSRLGYANVGRLFLANNRLTEIDNLPRNLS
YLDIRNNRIAVINRKTLDIFEKRSKSSDLKLFLSGNPWACTCEEKDFLGFVKGGGPRIGD
VTNITCGDTGNLLIETDESSVCPSGFVHYVTLTVSFMLMILTINLMIYFKQPLLIWFYEH
GVCLSLAARRELDERKKFDAFLSFTHKDEDLIEEFVERLENGPQKFQLCFYLRDWLLGVS
IPECISQSVKDSRRIIILMTNHFLKSTWGRLEFRLALHATSQDRCKRLIVVLYPEVENFD
DLDSELRTYMVLNTYLKRDDPNFWNKLIYSMPHIKVQHRVKWTDHEVIQFS
Download sequence
Identical sequences B4GKX6
XP_002019096.1.64850 FBpp0189719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]