SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0190887 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0190887
Domain Number 1 Region: 193-317
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000388
Family Galacturonase 0.037
Further Details:      
 
Weak hits

Sequence:  FBpp0190887
Domain Number - Region: 115-227
Classification Level Classification E-value
Superfamily L domain-like 0.00646
Family Ngr ectodomain-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0190887   Gene: FBgn0164361   Transcript: FBtr0192395
Sequence length 931
Comment type=protein; loc=scaffold_25:complement(434659..435629,436518..437668,437749..438038,438111..438277,438344..438560); ID=FBpp0190887; name=Dper\GL26780-PA; parent=FBgn0164361,FBtr0192395; dbxref=FlyBase:FBpp0190887,FlyBase_Annotation_IDs:GL26780-PA,GB_protein:EDW30559,REFSEQ:XP_002025071,FlyMine:FBpp0190887; MD5=e166a367979fb09eb6faaa4a6ee1288d; length=931; release=r1.3; species=Dper;
Sequence
MRIRLAGGTQFELHSEFFRRNRVNFFGIEGLRSTESDQVEFTKNAFQNNLGGYPDIQVRK
VQRVFIREGAFSGGEFVLRVENSQDVVVFPRAFQNMNISCTFRQVENLEMKEKTFYPNTN
SSAKSLVNLRIEDTGIEQIGSFDVSMRKVSFVRARIGRIQTNAFDVTEIKELSFEDCHIG
TIEARALTSKLLSDHVSFKGTTIGMIDSEAIIDCGISRLTLKNNTIMKIKSNAMQIYSVF
VFIQDNTVQHTEHNWLRVKDGEHIVIENNSFGHFNQFGLELAKLSKPFNCTFANNRLEDP
EQSSLNFSNCEVHRITVGHDCSCDNEWMHRLTDHDLDSEIICPLIASDRGCFNASSVNRR
HFVHEACSGSGRANNLTRHCTNGQWSTRTASDGGGGSLTIRQIASGIVVILVFVVVIAGL
MGCWTKGKSGNSSTSGSGNVDLCSFTHDEQRTMLKQTESLRDGDRTGKSIRKLASGKLTR
VECKNQVIDTIKEMPNGSSTIKELLTQHLLDCHDTSGSNSHSNSNSNSSRTSPTAPGEDY
YATSAMPHDRPTASAAPSAPNYEEPIYEEPQQPLCEPLLTSEYSSPSDPMTETPVYSEPI
NSTAPSASNENNDIPPAYQYALPMRHLGTQLPSTRGQTQLPAPPSQQHVSYATPVWRSTA
SATPNSGPLTGGGERADITPQRHVRDLRQDLEAMPQFHPNQLTSARYQRQFHHPPSQPQT
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXERCCRLVLCKSVLKAFLSN
Download sequence
Identical sequences B4H2J2
XP_002025071.1.64850 FBpp0190887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]