SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0191330 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0191330
Domain Number 1 Region: 139-324
Classification Level Classification E-value
Superfamily L domain-like 1.11e-33
Family Ngr ectodomain-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0191330   Gene: FBgn0164804   Transcript: FBtr0192838
Sequence length 350
Comment type=protein; loc=scaffold_19:complement(503830..504882); ID=FBpp0191330; name=Dper\GL27223-PA; parent=FBgn0164804,FBtr0192838; dbxref=FlyBase:FBpp0191330,FlyBase_Annotation_IDs:GL27223-PA,GB_protein:EDW27987,REFSEQ:XP_002023784,FlyMine:FBpp0191330; MD5=7d72b6dff26332dd1c07b03446412ee1; length=350; release=r1.3; species=Dper;
Sequence
MSRLRAGGKVLLVVLLQVLQWQAGETAFGRDECNELSVSSPCQCAPSMAEYEIYCPANAY
NVFPKFRLAIRPNSNVQIECNLTDANEYKQLPPLRIGEIERVQIQRCPLPGHTPIAGILE
HLGIRSPKMLIFESDNLGVNITRRHLDRLQNLKRLRFTSRRFTYIPADFLADLRNLSWLD
LRANIVELPAHLFDNLENLESLELGSNGLKHLPHGVFSRMPKLRHLNLWSNQLHNLTKHD
FEGASSVVDVDLHANGIEQLPRDVFSLLTNLTEINLSANHFRSLPEGLFEHNKQLRQVRL
LNNRVPLSTLPARLFANQPELRVLLSALRSSRHCPSDLLEQSSGDHEHSP
Download sequence
Identical sequences B4GYW9
XP_002023784.1.64850 FBpp0191330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]