SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0177140 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0177140
Domain Number 1 Region: 272-414
Classification Level Classification E-value
Superfamily PH domain-like 4e-41
Family Third domain of FERM 0.000000573
Further Details:      
 
Domain Number 2 Region: 162-271
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-37
Family Second domain of FERM 0.00000355
Further Details:      
 
Domain Number 3 Region: 562-647
Classification Level Classification E-value
Superfamily Moesin tail domain 2.09e-27
Family Moesin tail domain 0.000058
Further Details:      
 
Domain Number 4 Region: 21-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.47e-16
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0177140   Gene: FBgn0150639   Transcript: FBtr0178648
Sequence length 647
Comment type=protein; loc=scaffold_13:join(522657..522725,525055..525234,525771..525905,526103..526129,526241..527007,527081..527468,527965..528177,528239..528403); ID=FBpp0177140; name=Dper\GL13033-PA; parent=FBgn0150639,FBtr0178648; dbxref=FlyBase:FBpp0177140,FlyBase_Annotation_IDs:GL13033-PA,GB_protein:EDW26477,REFSEQ:XP_002022442,FlyMine:FBpp0177140; MD5=ecc416bf9e62b9481ec2e4beb47d5e4f; length=647; release=r1.3; species=Dper;
Sequence
MVVVSDSRVRMPRYGGVSVKRKTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLRE
VWFFGLQYTDSKGDSTWIKLYKKPESPAIKTIKYLKRVKKYVDKRTTSDSNGVHHSETSE
EDDDADDMTGSMPFSTWVMNQDVKKENPLQFRFRAKFYPEDVAEELIQDITLRLFYLQVK
NAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTAGFLANDRLLPQRVIDQHKMSKDE
WEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWLGVDALGLNI
YEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRVRINKRILALCMGN
HELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQEYEDRLKQM
QEEMERSQRDLLEAQEMIRRLEEQLKQLQAAKDELELRQKELQSMLQRLEEAKNMEAVEK
IKLEEEIMAKQMEVQRIQDEVNAKDEETKRLQDEVEEARRKQAEAAAALLAASTTPQHHH
VAEDENENEEELTNGDAGGDVSRDLDTDEHIKDPIEDRRTLAERNERLHDQLKALKQDLA
QSRDETKETANDKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM
Download sequence
Identical sequences B4GVJ0
FBpp0177140 XP_001354985.2.19638 XP_002022442.1.64850 FBpp0280425 7237.FBpp0280425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]