SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0178285 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0178285
Domain Number 1 Region: 163-205
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000000000000772
Family Hormone receptor domain 0.0026
Further Details:      
 
Domain Number 2 Region: 266-428
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000119
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0178285   Gene: FBgn0151783   Transcript: FBtr0179793
Sequence length 591
Comment type=protein; loc=scaffold_11:complement(2495242..2495614,2495687..2495859,2496047..2496310,2496381..2496678,2496733..2496790,2498844..2498954,2499120..2499212,2499882..2500287); ID=FBpp0178285; name=Dper\GL14178-PA; parent=FBgn0151783,FBtr0179793; dbxref=FlyBase:FBpp0178285,FlyBase_Annotation_IDs:GL14178-PA,GB_protein:EDW26013,REFSEQ:XP_002022072,FlyMine:FBpp0178285; MD5=69802062013a48a5f4ae564ede8db530; length=591; release=r1.3; species=Dper;
Sequence
MTDQPSTDETGGGVATHFFARLMRLTGVSLSSAAAAAAPNSMPEPTTSSLMTTESPTTAA
AELAPSYLIDRVTQVARIALEVTTTASEVLAEALPEVDTSFANGTIHGNLTLAAAAAANY
ENCSAIFANYTQPEADLGTRIQLSVNEFELSHVDYKLKADKLKELLGIYCNFTWDTLTCW
PPTPAGVMARMHCPAGFHGVDPRTNPVAVPQTLVVVSRRSRIRHIYARPPYVLLEYARTA
MFMWMFIEGLYLHNMVTVAVFQGQFPLKFFSRLGWCVPILMTTVWARCTVMYMDTSMGEC
LWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVL
LPLLGITNLLHQWPVLKSATNFAVWSYGTHFLTSFQGFFIALIYCFLNGEVRACLLKSLS
NQLSLRGHPEWAPKRPSMYSGAYNTAPDTDAVGQQPVAETQAATGGLRTSPINRRQNTSA
SIVMIHEPNHRQRLVQRNHNNNNQESPRRQRGERTDDEDRIGIAAGAGVEAEVVVVQDSV
GGAVGRKRETRIHAGTKWMISGLCFRGQKVLRVPSTSSVPPESVVFELSEQ
Download sequence
Identical sequences B4GTZ3
FBpp0178285 XP_002022072.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]