SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0178680 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0178680
Domain Number 1 Region: 508-870
Classification Level Classification E-value
Superfamily Arginase/deacetylase 4.22e-113
Family Histone deacetylase, HDAC 0.000000963
Further Details:      
 
Domain Number 2 Region: 78-435
Classification Level Classification E-value
Superfamily Arginase/deacetylase 8.15e-105
Family Histone deacetylase, HDAC 0.00000306
Further Details:      
 
Domain Number 3 Region: 955-1050
Classification Level Classification E-value
Superfamily RING/U-box 5.18e-21
Family Zf-UBP 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0178680   Gene: FBgn0152178   Transcript: FBtr0180188
Sequence length 1095
Comment type=protein; loc=scaffold_14:complement(1436003..1436379,1437003..1437072,1437274..1437909,1437980..1439393,1439453..1439724,1440314..1440497,1440557..1440687,1440769..1440972); ID=FBpp0178680; name=Dper\GL14573-PA; parent=FBgn0152178,FBtr0180188; dbxref=FlyBase:FBpp0178680,FlyBase_Annotation_IDs:GL14573-PA,GB_protein:EDW26836,REFSEQ:XP_002022770,FlyMine:FBpp0178680; MD5=07d19577613fca8ba4ce36a478ce00b1; length=1095; release=r1.3; species=Dper;
Sequence
MAMKSGSNSNATAASSSSSGAIKSSSVGAELPKRSETLLEAKRRARNMLRHQGNTPAMQE
TVTDIFQTAVKSRPLVRGETALVYHQSMEQHCCRWDPKHLECPDRFNRVLDRCNELKLLD
RCLPVSARLATKQEILRLHTAQHFELLEQTSEVCDDQSMEELSSRFDSIYIHPSTFQCSL
LASGSTIDLVDSIITGKAQNGMAIIRPPGHHAMKAEFNGYCFFNNVALAAQHALDVHKLE
RILILDYDVHHGQGTQRFFYNDPRVLYFSIHRFEHGAFWPHLQESDYHAIGEGPGLGFNF
NVPLNETGMGDGDYMAIFQQLLLPVAMEYQPELIIVSAGYDAALGCPEGEMQVTPAFYAH
LLNPLLRLADSRVAVVLEGGYCLESLAEGAALTMRTLLSDPCPVLVEPLLPPKRSMSKSI
LNCIFAHRPYWRCLQLQGTYEPSELKTKDRSRDLHIVERAWVGGPPPVTVYPTRDTSVQH
LIPDAVVADNTARLHRLRLETILTVPAVRVCYAYNPEMMEHRNLDDLGHPEQPKRIQFIH
KMHEDYQLLGRMKQLSARAATTDEICLAHSRSHVNTMRRVLGRDKEDLQAQAATYNSVYL
HPATFGCATLAAGSVLQAVDSVLRGESRSAICNVRPPGHHAEPDQPHGFCIFNNVAIAAQ
YAIREFGLKRVLILDWDVHHGNGTQHIFESNPKVLYISVHRYENGTFFPKGPDGNYDVVG
KHTGAGFNVNIPWNKKGMGDLEYALAFQQIVMPIAYEFQPELVLVSAGFDAAIGDPLGGC
KVSPEGYGLFTHWLSALAGGRIVVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPLLGVVA
LTRPPTTAFQSCLETLQCCVEVQRQYWKSLEFVGYRLPHGYQIGENNNEDFLAASLLKLN
ISSDDAQGAAGGPTDGDQADPGQERPSDSKPKVKVKPPNHSTAAPEEMFAIPPSKTCPHM
RMLRPELVPQSINTRAPCGECISRSENWMCLSCHYIGCGRYVGRHMQRHCEALEHTLVMR
LQDHAVWCYVCGVYLDNPRLFEYKNRAHQDKYGRPLAWRYPCAKRADGCYPLDPESDSEE
EADHIANGSYLQEAQ
Download sequence
Identical sequences B4GVZ1
XP_002022770.1.64850 FBpp0178680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]