SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0179236 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0179236
Domain Number 1 Region: 91-171
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.01e-29
Family Nuclear receptor 0.0000142
Further Details:      
 
Domain Number 2 Region: 159-173,207-349
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.24e-28
Family Nuclear receptor ligand-binding domain 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0179236   Gene: FBgn0152733   Transcript: FBtr0180744
Sequence length 359
Comment type=protein; loc=scaffold_28:complement(1046939..1047139,1047639..1048517); ID=FBpp0179236; name=Dper\GL15129-PA; parent=FBgn0152733,FBtr0180744; dbxref=FlyBase:FBpp0179236,FlyBase_Annotation_IDs:GL15129-PA,GB_protein:EDW31073,REFSEQ:XP_002025551,FlyMine:FBpp0179236; MD5=5934c456a0e94b0d98fad987f61e393b; length=359; release=r1.3; species=Dper;
Sequence
MDNCDQDAGFRLGHIKEEVKPDISQLNDSNNSSFSPKAESPGPFLQNMSMVHVMPSGNSS
ENQGQMAQASAGGASAQQQYPPNHPLSGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRT
VRKDLTYACRENRNCIIDKRQRNRCQYCRYQKCLSCGMKREAVQEERQRGARSAAGRLSA
GGGSVGGGSVGSGSGGGGGPWGSVGGNGADEFMAFNVSRDFTIERLLDAEQRAEAQSGDR
ALAFLRVGPNSTVQPDYKGAVSALCQVVNKQLYQMVEYARFMPHFAQLPLDDQHCRVEHP
GDDGRFAQLLLRLPALRSISLKCLDHLFFFRIISDRPLEELFIEQLESQPPPGLTLKPE
Download sequence
Identical sequences B4H3X2
XP_002025551.1.64850 FBpp0179236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]