SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0179863 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0179863
Domain Number 1 Region: 190-263
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-19
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0179863   Gene: FBgn0153360   Transcript: FBtr0181371
Sequence length 276
Comment type=protein; loc=scaffold_320:join(24652..24943,25009..25289,25309..25493,25564..25636); ID=FBpp0179863; name=Dper\GL15756-PA; parent=FBgn0153360,FBtr0181371; dbxref=FlyBase:FBpp0179863,FlyBase_Annotation_IDs:GL15756-PA,GB_protein:EDW32959,REFSEQ:XP_002028696,FlyMine:FBpp0179863; MD5=ba65cd47615be8de45145d5ac0d46d0f; length=276; release=r1.3; species=Dper;
Sequence
MRNVNVSQAAPSGGRRAGDGLKVTLSSDGSLDTNDSFNSHRHHPLNHQDAIGGIMGMAPN
ALSSAPVTIGASTDLLTPNAAATRRRRKLPEIPKNQKSSILHLLGGTNYGSLADEFRTGG
GGIIGGPLAAPRTGQQRSFLSLKCGYLMDEDSSPDSERLQSLGDVDSGHSTAHSPNDFKS
MSPQITSPVSFNKKEKKPCIDYFYSLKNVSFCAFHPRDHRFIGFITKHPIVQRFACHVFK
GSESTRPVAEAVGRAFQRFYQKFIETAYPIEDIYIE
Download sequence
Identical sequences B4HCW7
XP_002028696.1.64850 FBpp0179863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]