SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0180200 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0180200
Domain Number 1 Region: 596-793,852-928
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.39e-85
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000233
Further Details:      
 
Domain Number 2 Region: 124-228
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-31
Family Second domain of FERM 0.0000594
Further Details:      
 
Domain Number 3 Region: 226-334
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-21
Family Third domain of FERM 0.001
Further Details:      
 
Domain Number 4 Region: 466-559
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.00051
Further Details:      
 
Domain Number 5 Region: 34-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-17
Family First domain of FERM 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0180200   Gene: FBgn0153697   Transcript: FBtr0181708
Sequence length 940
Comment type=protein; loc=scaffold_32:complement(215207..215296,215366..215543,215596..216220,216282..216958,217025..217204,217245..217537,217604..217884,217984..218125,218221..218313,218394..218501,219032..219187); ID=FBpp0180200; name=Dper\GL16093-PA; parent=FBgn0153697,FBtr0181708; dbxref=FlyBase:FBpp0180200,FlyBase_Annotation_IDs:GL16093-PA,GB_protein:EDW33017,REFSEQ:XP_002026094,FlyMine:FBpp0180200; MD5=6d43e83eef90a4670984ff08cc7b1312; length=940; release=r1.3; species=Dper;
Sequence
MFERFRLSNLSRNFRLRGGSSELARDKKNQQQRQQCVTVLFLDDITHTFRLEKRAKGSEL
LDQVFQYLELSERDYFGLLFPQKPGDVVRWVDAQKQFKKQCSSVSLDNDAVPLLEFRVKF
FVSDPSRLQEEFTRYQFYLQIKRNILLGKLPCSSNTQCLLASYTVQSELGDFNAAEHQVG
YLSGLQLLSEQTPEAERKVSELHKLHRGQLPADAEYNYLEHGKRLELYGIDLHKATDSSG
KDLQLGVSAVGLLVFQHALRLRREPSENYDTLLGFGMISHKHAKALWKSCVEHHSFFRLK
RPHRLSRFLNISLGSKFYYSGRTELQAVQSQSSAAAYTSICAVAQQKAAGRRRRRRGCGG
SGGSESAASQHNGKPSASTILTITKTSRPHDNKVTSKEADSMPRKAWEQQSDEYDIQLDV
GFIEQCSRRFESPSPMPPAYSSGQHSPLLLPTTIADAVGSQPDSGSDLITIRLQADDQGR
YGFNVKGGVDLSLPVQVSKVVPHTPADRCTPRVCEGDEVLMINGRDVHGLRHEQVVSMIR
DCRHQSSGELLLTVRPQRSAPLLMEEEPLYQYVPESDEIGSHSNLLDGDALFTQSLLLLS
DGLASGALLAQYEVMYRKNPDLAITEARKAANAAKNRYRDISPYDCTRVSLVNSLTGDYI
NANYVNMEIPGGAVNRYIATQGPLASTTTDFWRMVQQESSHLLVMLTTVMEAGRQKCHQY
WPVTGEELQLADGFSVRCLSEKPDETGSFVFREFVLKDKHEQRHIHHMQYLAWPDHCVPS
DPNLFLEFTERVRAARNRTLLQEIEESLKQVRLMDADAGDDENGGLMRERKCAASNGATP
EDETPVSTSVHQCISAANPPVIVHCSAGIGRTGVLILMDTALALMESREPVYPLDIVRTM
RDQRACMVQNVSQYRFVCECICAAYMKMSRSSAAIHDDDD
Download sequence
Identical sequences B4H5G5
XP_002026094.1.64850 FBpp0180200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]