SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0181700 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0181700
Domain Number 1 Region: 1372-1481
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000151
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0181700   Gene: FBgn0155196   Transcript: FBtr0183208
Sequence length 1485
Comment type=protein; loc=scaffold_4:join(4738418..4738426,4738487..4738945,4739022..4739739,4739949..4740952,4742387..4742489,4742616..4743244,4743321..4743518,4743718..4744574,4744824..4745304); ID=FBpp0181700; name=Dper\GL17593-PA; parent=FBgn0155196,FBtr0183208; dbxref=FlyBase:FBpp0181700,FlyBase_Annotation_IDs:GL17593-PA,GB_protein:EDW36061,REFSEQ:XP_002018222,FlyMine:FBpp0181700; MD5=acb28435d1f63097d6ceb9b512d1a0ef; length=1485; release=r1.3; species=Dper;
Sequence
MATVFGASKSKFPKHVVPDVVAEKEEEEEEEEEEDDDDEEEDSAESGSTTSFSLQECINE
FRARRIRRVSTQSRDCDNNHNMPSEDQPVRVRGTSADADLINQNRCNKAQERKGKPCKNG
FCYCFTSDSGDCASTAPTRESHVRQPRRSRRSESTKAASASKPLVQNHLDSQRQQVGRRH
SEPPNVKQTSNIPLTAISSICAVGDDAPLIQIIQELRDNCVVSEVRVNRQKLSGSGCQPR
SSPVKTCKVKAYDPITYKPTAPALSNISEQDSALEEEPEMAQTEQPTSLQSARQSSRSRR
SSGAGGRLLQKRLLQGLGNFKRRDCQEPPPKPPRRSCQSLDGKFSLSSLASTTPSVREAE
RVLDEFLRQRGVTVPSSNNNSPRKDKKSKRRSYPMAEVEKPRRSRQLPTCPSLSDIERVV
ESKRGSNYARNIQQASSKGKNAVADKPMKEILLGWTEPKINDMLNYENKRSTHFKTQAPM
AEPQVAIGWQLPQPVVPKISLDTVDGSMCENLASNIDRKHTPIKYPRGIKSAGGQTSNKF
IWGEQLRNFSPLKAANKQPTLKTKSKNFLNNSKNKILRFVSPKKSNHPENPARRPTPTPR
LCTVGVQTSTSQLDLQSQSPPGSYHSPMQSTPSATTTSTRQQPDKESSGDQPYFDFERKI
EAPNPPKKMPRATNRARKLNFHTEAEAPTTYRSFHKDLDQDVTITKMGYLLSNIRAKLEA
SDDRAVRTFRDSSRVEAIERQKESFDCIDGPHSLSATSATTQYQLPTRHQRDLDCEPIYS
EIEEDCLRIRGSPQYEVRTAVERQPSDAQTSSSTATGSESTAAVSDLTVPADLSILYARV
QKPQKKPQPSLPPVNLTAQPVALGQCLQESLKSGSFFKFMPLPDEPSSECSRSESTSETT
DSSVIRKPKPTSPPMHQSLNNINERNSPPKKNRNLSRSELSLQRSQIFLDNFCRSELVLD
QDEQLNTRLEKIPNPVAPRNEDAVSYDMPEGLYDDYAIEDASAGSSFATNDYGSCQIEPP
PPPSENQSTPKKKSQRYTTKPPSNLSIDINDATQSPARPFGHNLSHSCPTTPQQPAKPSA
QLAHNSSSLGELVQSLPSPTDSQLMSVSALARYRLLKDALRRSYRKGKDFFLAEKHRLTH
SLNMSRDQSNQTDGELDSSTYYASFNLDCLLNESLTTSEQLAQAVSICRKMPELEISNEM
VEAERLLLFSTLRQSSPADPGQASDAVLAARRQAQCVLIDAMQLPVRSDASQDMFFNYHY
ICTYEFEGRICSTQSVECQNGVALFRDCGLEFYSAGPVEAMELRCQIFMFRLRRSLRCRW
SQPRQCETQASDRICLRSSRSWQLPLTTHTKSTNLAPEISVTGRVEVRLPKSHYSGYLNV
EDPQRKHHWNRRWCTLDGVQLSVWQHEDDLSEQPPLFSLHLQGCPQASIAAAPRELCARA
RSFLLREKEAALGFFFAADTQPELDEWLLHLNESLSFAKRWLVAP
Download sequence
Identical sequences B4GHU1
FBpp0181700 XP_002018222.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]