SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0182414 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0182414
Domain Number 1 Region: 209-354
Classification Level Classification E-value
Superfamily PH domain-like 5.45e-42
Family Third domain of FERM 0.00000563
Further Details:      
 
Domain Number 2 Region: 101-208
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-31
Family Second domain of FERM 0.0000085
Further Details:      
 
Domain Number 3 Region: 9-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.74e-23
Family First domain of FERM 0.00019
Further Details:      
 
Domain Number 4 Region: 551-620
Classification Level Classification E-value
Superfamily Moesin tail domain 5.36e-22
Family Moesin tail domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0182414   Gene: FBgn0155909   Transcript: FBtr0183922
Sequence length 620
Comment type=protein; loc=scaffold_30:join(251976..252529,252589..252691,252757..252966,253034..253270,253351..253886,253937..254159); ID=FBpp0182414; name=Dper\GL18307-PA; parent=FBgn0155909,FBtr0183922; dbxref=FlyBase:FBpp0182414,FlyBase_Annotation_IDs:GL18307-PA,GB_protein:EDW32670,REFSEQ:XP_002025774,FlyMine:FBpp0182414; MD5=16a73b901ca17c151499f0570068fda7; length=620; release=r1.3; species=Dper;
Sequence
MSPFGSKKNRSLSVRVSTFDSELEFKLEPRASGQDLFDLVCRTIGLRESWYFGLQYVDTR
NNVSWLKMDKKVKDQRVELHANNNIYVFSFYAKFFPENVSEELIQEITQHLFFLQVKQSI
LSMDIYCRPEASVLLASYAVHVQYGPYDYETYKDGMLAGGELLPKGVTDQYQMTPEMWEE
RIKTWYMDHEPMTRDEVEMEYLKIAQDLDMYGVNYFPITNKNKTKLWLGVTAVGLNIYDE
RDKLTPKTTFQWNEIRHVSFDDKKFTIRLVDAKVSNFIFYSVDLHINKMILDLCKGNHDL
YMRRRKPDTMEIQQMKAQAKDEKQRRQIERKKFIREKKLREKAEQDRYELEKSFEHLQNE
MRMASDALRRSEETKELYFEKSRVNEEQMQLTECKANHFKTEMDRLRERQMKIEREKHDL
EKKIRDADFFVHQLTVENDKREAETEKLKKELICAKMAEREATARLLHFLNSGRKSSTDS
LLTASTVSNAVNTSSSLAAISTPSLTTSSSTNDMETAGGADLTTSASHYLVQGDNSSGIS
DDFEPKDATILEYLRKSKKQVQNQLQTLRSEIAPHKIEENQSNLDILSEAQIKAGENKYS
TLKKLKSGSTKARVAFFEEL
Download sequence
Identical sequences B4H4Q8
FBpp0182414 XP_002025774.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]