SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0182559 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0182559
Domain Number 1 Region: 108-215
Classification Level Classification E-value
Superfamily PH domain-like 3.96e-24
Family Phosphotyrosine-binding domain (PTB) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0182559   Gene: FBgn0156053   Transcript: FBtr0184067
Sequence length 228
Comment type=protein; loc=scaffold_3685:join(1027..1397,1459..1516,1590..1774,1845..1917); ID=FBpp0182559; name=Dper\GL18452-PA; parent=FBgn0156053,FBtr0184067; dbxref=FlyBase:FBpp0182559,FlyBase_Annotation_IDs:GL18452-PA,GB_protein:EDW33497,REFSEQ:XP_002029150,FlyMine:FBpp0182559; MD5=64c696c94596dfa82170fcc1cd67f8d0; length=228; release=r1.3; species=Dper;
Sequence
MEDSTSSKSDGDGSDQEDGIGGMGMAEREREPKLRQVEDDELGDGLKVTLSSDGSLDTND
SFNSHRHHPLNHQDAIGGIMGMAPNALSSAPVTIGASTDLLTPNAAATRRRRKLPEIPKN
QKCNFPFCISDQGLRMVDRSGPNNKKEKKPCIDYFYSLKNVSFCAFHPRDHRFIGFITKH
PTVQRFACHVFKGSESTRPVAEAVGRAFQRFYQKFIETAYPIEDIYIE
Download sequence
Identical sequences B4IR92
FBpp0182559 XP_002029150.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]