SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0182901 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0182901
Domain Number 1 Region: 523-714,810-959
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.33e-87
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000157
Further Details:      
 
Domain Number 2 Region: 406-507
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.12e-19
Family Anticodon-binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 234-330
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.1e-16
Family Anticodon-binding domain 0.0021
Further Details:      
 
Domain Number 4 Region: 90-184
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000441
Family Anticodon-binding domain 0.0041
Further Details:      
 
Domain Number 5 Region: 693-812
Classification Level Classification E-value
Superfamily GAD domain-like 0.0000000216
Family GAD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0182901   Gene: FBgn0156395   Transcript: FBtr0184409
Sequence length 1091
Comment type=protein; loc=scaffold_1:complement(4429762..4430637,4430705..4432168,4432227..4432316,4432378..4432556,4432616..4433113,4433228..4433396); ID=FBpp0182901; name=Dper\GL18794-PA; parent=FBgn0156395,FBtr0184409; dbxref=FlyBase:FBpp0182901,FlyBase_Annotation_IDs:GL18794-PA,GB_protein:EDW28723,REFSEQ:XP_002014727,FlyMine:FBpp0182901; MD5=8ec328ba4fd7908c603ee594c52d1a6b; length=1091; release=r1.3; species=Dper;
Sequence
MSYTPQQIMSGRYRGGGGGGGRYGGGPGGPPGGPGYGGSGYNDFDNYRGGGNGGGNVGPN
VSYNDMMQLMSAMASNINMNSQPPQPMRQSCGELRNHHCGLFVELSGRLIKKRVNRFAEL
RDRNGGACQLVVLEDKHPRVARRMNNMPENTTLTIVGQVMRRPHNSCNQTMPTGEIEVEV
QDILNIHFPASGTKRAGDKRSYSTMVQQQSTQGITSTEYKIARNENILKYFENRDLTCND
LRRDDVGKTVTLVGWIPSTKNNKFLQLKDGYGQTQLMIEDQSLIDTFMSTPDQTVLQVVG
KVLGRPKANINLKYDTGEVEVSVTSVKILNPDDPYDGPIKLKEKQQKMSIDDLEAEEAAA
CGSSHADTNNGEPKEDVGPEATSSTNNGSNPEQRVKVADTNKFADRTHNCGELTSNEINE
KVVICGWLEFQRMNKFFILRDAYGQTQVLLLPKTKGLEEYSETGVPIESIVRVEGTVIPR
PGATVNPKMSTGHVEVEADTVLVLNPSKKNLPFEIRKFNRAGERLRLTHRYLDLRFNDMQ
HNLRLRSSVIMKMREYLVNYLGFVEVETPTLFRRTPGGAQEFVVPTRKAGHFYSLVQSPQ
QFKQMLMSGGVDRYFQVARCYRDEATRPDRQPEFTQLDIELSFTSRDGIMQLIEETLRYS
WPKHLPKLQTPFRRITYEEALEKYGNDKPDTRFGFLLNNVSEIIDKSEEYKGKYEGGLAA
YAIVVRASEAFWNGAARKHYEGLGKDFIGTLFVRKFGPATDVQDRLGKLLGEQVANEITE
KFDLEENDLLFLGIGPKVETRALLGRIRLDYHDFLVENVKMKKPNDYRFLWVIDFPLFER
NRETNQLESVHHPFTQPHIDDLDNFATSCENLENIRSQAYDLVLNGQEVGGGSIRIHDRD
MQQFILEQILKIPHEHLSHLLSALESGCPPHGGIALGLDRLIAILCRARSIRDVIAFPKS
LNGRDPLSNAPVPISEEDMKLYHLSVLEEEDASTNSTSLDQEDDDPDRVRAPPSPMSGNS
DTEQPEMEVDIKVEAIDEPQPEKPDEEPESSAAVPVADAETPESPSPPPQPATPVPAAPT
TRAKRVVKKKV
Download sequence
Identical sequences B4G8P3
FBpp0182901 XP_002014727.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]