SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0183704 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0183704
Domain Number 1 Region: 873-997
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-28
Family Nuclear receptor ligand-binding domain 0.00000055
Further Details:      
 
Domain Number 2 Region: 772-851
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-26
Family Nuclear receptor 0.0000191
Further Details:      
 
Weak hits

Sequence:  FBpp0183704
Domain Number - Region: 65-118
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000732
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 
Domain Number - Region: 293-354
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00549
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0183704   Gene: FBgn0157195   Transcript: FBtr0185212
Sequence length 1004
Comment type=protein; loc=scaffold_1:join(9030184..9030667,9057813..9058138,9058837..9059985,9060329..9061384); ID=FBpp0183704; name=Dper\GL19597-PA; parent=FBgn0157195,FBtr0185212; dbxref=FlyBase:FBpp0183704,FlyBase_Annotation_IDs:GL19597-PA,GB_protein:EDW29243,REFSEQ:XP_002015247,FlyMine:FBpp0183704; MD5=6ffe68593a797b4851bc54728aa421a7; length=1004; release=r1.3; species=Dper;
Sequence
MRDRLASLIVVKQEGGNNDTNNNNNNSHQDLPASMLLQPPIKCEASLYALSPYESSLYHE
INNNSCYRQNLNNQQPQQQQHHHHHQQHHSQAHQHQHQLLPPPLPPLIYPCRNLFPDGCD
ITHLACCSSSSTSTSTSTCTSVSSSSSSCSPTNNSNSSGSGTAAAAVTAGGATSAASQPR
KSKLLVERKVGKTDSNTDSATETTEAPATTATSATSTAGAATTTTATTTTTGGTTASATA
TTAAAIHTTKISQVRLNNPATTSMLLLQPNSSFSSLSPFDNFSSQSATTTTTSSVTAAAA
GHHHLQQQQQQQQHHHLQQQHLQHQQQQQQHHHQQILNSQQHLLKTESLLSHEEDQLISN
LNDVAGSHSELFSDLFFPSDSNNSLLSPTTSGYPDNPSGEDLTSSIENLTKLTCLRDKRL
SSIPEQQLSSEQEQQLCLLSLRSSSDPAIALHAQQQQQQQQPQQQQQQQEQQRQPGSGQI
QLISPIGGPLSCGSSLPSFQETYSLKYTSSSGSSPQQASSSSTAAATPTDQVLTLKMDED
CFPLTSAAEVMSGWNASPAPAPAQLQQLHTLQTQSQSQSQMSHSHPHPNSSSSGSNNNNN
GGSSGYNYHGHFNAVNASANLSPSSSASSLYEYNGVSASDNFYGQQQQHPKLLNYNSHNG
ERYSLPTFPTISELAAATAAVEAAAAASISASVGPTPVRRSSLPVQRTVSPAGTSAQSPK
LAKITLGQRHHAHAHAHAHPLQLSSAPNSSASSPASAAGADLQAGRLLQAASQLCAVCGD
TAACQHYGVRTCEGCKGFFKRTVQKGSKYVCLADKMCPVDKRRRNRCQFCRFQKCLVVGM
VKEVVRTDSLKGRRGRLPSKPKSPQESPPSPPISLITALVRSHVDTTPDPSCLDYTHYEE
PSMSEADKVQQFYHLLTSSVDVIKQFAEKIPGYLDLTPEDQELLFQSASLELFVLRLSYR
ARSDDTKMIFCNGTVLHRSQCQRSFGEWLNDIMDFSWESSQPGD
Download sequence
Identical sequences B4G744
FBpp0183704 XP_002015247.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]