SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0184125 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0184125
Domain Number 1 Region: 1087-1215
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-18
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0184125   Gene: FBgn0157615   Transcript: FBtr0185633
Sequence length 1224
Comment type=protein; loc=scaffold_44:complement(443634..444353,444416..444714,444777..445146,445207..445428,445484..445672,445738..445870,446045..446216,446272..446649,446713..447076,447158..447634,447788..448120,448195..448212); ID=FBpp0184125; name=Dper\GL20018-PA; parent=FBgn0157615,FBtr0185633; dbxref=FlyBase:FBpp0184125,FlyBase_Annotation_IDs:GL20018-PA,GB_protein:EDW35023,REFSEQ:XP_002027167,FlyMine:FBpp0184125; MD5=f1b9c1e3260acb504f17a92357feae1e; length=1224; release=r1.3; species=Dper;
Sequence
MDPFTQHMLEKAEQRSRALGISNASKFPLTECSVASSSVAQNLEPTKPMPNRSHSPAGHS
ISSSSSSSGGGGGKVVTLDKAMLEASPTKPLRHYAAINKENMEMGIEINITSAKAIGVQV
EIQEQEVTDDEETPGDAVDNPVQAINQPLARLRDTSRSQLKRMGDLYSNTADLSSPIHRT
EAQFHAGDDDDDSSRRCPRQGKQRLGKLAALADTINQWEDDTAHHDVHRPIEAVAIPPPK
PELPSRRGEKGPAPQPPKRDEGDEGGKTKQLKWDPKGEAAPTATDTAKPPVPGKSTAVSK
VARTFGPTAAVSTKIASVSGTSIKSGLVSGRAAIFENKAGAGGQMQGGHRFQKDPCELSL
KERMKLFETGNNNTAILPKAPIASAASISQIRQEESKAHVAAVHPVTAAAVSSTVSAGAA
HKPKPENKLRDKVAALVANAQSSAESRIKDIDRQRQEDMQIIANRFNKQKELFVPQPAAR
ATPAPAPASVPVTVYKAVRPMPPPPPPPMSGLSPAIASSKRRSPGDAPIIDEESKRARKS
NSERLYPALSDLDSSGENCCATVTATATDDSDQQEQDETESCMDESEDQSQTEDSSTGMC
NGSLGREIMNAVQRNEAEIQQQGKKTVRYADQDFYYNHEGQDSSVNSSQVSAGIDDYLDE
ALVEDCGSTQDDDSDGADEHNSSHLSLGSKGTTASNSFSFRKNPTSTSCLPVDEHQEIMD
VQTPLLSGAQPVRSELSVNQDNDNLVTLVHTVSFYRRQQSANSSSSTPVRKICREQQVMR
SALAGDCHAKHKLEYDSPQHGEMAEAGAGASKDDHTDDDDEELQNARDSNDATQAQDKIK
KLLSEVCKQQQVIGQASQALNLCAATVEFSGSTESVEGERYLLLATHRRQSCLDEVQRLR
VENSVRPVGGPKEKGLLTVKDITIPLRHEYLRKMASGSINGHHLVCLLKYNEHVLATKTV
PTMPGLVSVKFPDVLQLNNVYADFRITLEIYGMLAQRDQLPHDLKYHINLNKKGGVKTPK
KKGGENRLVMPPVQSPAGPHVVRTPQLVQYGFAIFSLREIQRTSWTLTQVLGVSPLEGVV
HMKVNCELSVSVEYKGFLTMFEDISGFGAWHRRWCYLNGSVLNFWKYPDDEKKKTPMGSI
DLNACSSQKVTTAPRDICARLNTMLLECERPAKDTDQESLIIVPNGRTTTVRHLLSADTK
EEREEWSAYFNKALTLLRAWGPTH
Download sequence
Identical sequences B4H8I8
XP_002027167.1.64850 FBpp0184125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]