SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0185169 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0185169
Domain Number 1 Region: 772-1062
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.03e-53
Family Rhodopsin-like 0.0018
Further Details:      
 
Domain Number 2 Region: 347-645
Classification Level Classification E-value
Superfamily L domain-like 3.4e-49
Family Internalin LRR domain 0.064
Further Details:      
 
Domain Number 3 Region: 174-412
Classification Level Classification E-value
Superfamily L domain-like 5.67e-43
Family Ngr ectodomain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0185169   Gene: FBgn0158657   Transcript: FBtr0186677
Sequence length 1381
Comment type=protein; loc=scaffold_16:complement(1239532..1239839,1239912..1241684,1242004..1242371,1242438..1242581,1242635..1242700,1242770..1242910,1242973..1243110,1244241..1244309,1246018..1246089,1246168..1246239,1246908..1247051,1247433..1247588,1248424..1248495,1249557..1250179); ID=FBpp0185169; name=Dper\GL21062-PA; parent=FBgn0158657,FBtr0186677; dbxref=FlyBase:FBpp0185169,FlyBase_Annotation_IDs:GL21062-PA,GB_protein:EDW27375,REFSEQ:XP_002023247,FlyMine:FBpp0185169; MD5=780e650d9b15ca3c3665aa38d5be22fd; length=1381; release=r1.3; species=Dper;
Sequence
MAMHCRRRRESVCACSGDSGSLWVRLKLCSLLLLLLLLLLLLLPVTASNTTLAVSEETKE
NQASAKQENHRGEPLSEQFSQITVNRTSATPTATPNTTPTTTPLSTPSTAMATGIRENVM
LPSADPEREAQILYEKSLQEYHGSQMATAATADAGSGRPQQRTLHSLCERWQQKHCHCSG
SLESVKLTCRGIGILAVPVNLPTEVYYLDLGNNNLTKLEANSFFMVPHLEELFICWTLSD
NSIINMDPNAFYGLGKLKRLNLQNCGLKSLPPQSFQGLGQLTSLQLNGNALASLDGDCLG
HLQRLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIINDEDFPRMPNLIVLLLKR
NQIMKISAGALKNLTALKVLELDDNLISSLPEGLNKLSQLQELSMTSNRLRWINDTELPR
SMQMLDLRANPLSTITAGAFRGMTKLRKLILSDVRTLRAFPDLEACHALEVLKLDRAGIQ
EVPTNLCRQTPRLKSLELKTNSLKRIPNLSSCRDLRLLDLSSNQIETLQGKPFHGLKKLN
DLLLSYNRISALPQDAFQGIPKLQLLDLEGNDITSIHKEAFAGFTALEDLNLGNNIFPEL
PESGLRALLHLKTFNNPKLREFPPPDTFPRIQTLILSYAYHCCAFLPLVAMSAKRKTSQV
QEAVLFPSDAEFDMTLWNNSMMNIWPQMHNLSKQLGAAMHDPWEGATFGEDQLQSPTGGQ
SPTSYMEEYFEEHDVSGPATGYGFGTGLFSGMSADDFQPGSVQCLPMPGPFLPCADLFDW
WTLRCGVWVVFLLALLGNGTVVFVLLCSRSKMDVPRFLVCNLAAADFFMGFYLGILAIVD
AATLGEFRMFAIPWQMSLLCQLAGFLAVLSSELSVYTLAVITLERNYAITHAIHLNKRLS
LRQAGYIMSVGWVFALIMALLPLLGVSDYRKFAVCLPFETTTGVASLTYVISLMVINGCA
FLTLMGCYLKMYWAIRGSQAWNTNDSRIAKRMALLVFTDFLCWSPIAFFSITAIFGLQLI
SLEQAKIFTVFVLPLNSCCNPFLYAIMTKQFKKDCVTLCKHFEESRVMGGGTGARGAVAR
AKRGELPPPLLPATAAHPPGCRCLRMLPSEMPNWHKMEQAPGLWQRLRTFCCGDRRRRRK
QRRQPQQRRPRAYTAAAANPYQYQFAELRQQRQNRASSISSENFCSSRSSSWRHGPPSSA
PVPQSNCSMPLKIMEPHGHMHGHGRRRHSAWLITRKTSQDSNLSSSRNDSSASATTASTS
TFRLSRSSAGSSTPLPSIIAHNGKTLNEVTKPRLVRQEAVQEEEDSSPPRLGVRFLPTIP
SAADSSVILEDGDSANTSGVAGFLGMPQPGASSGFLIAPTSTPPVVLQPEKPPPDPNDAP
P
Download sequence
Identical sequences B4GX48
FBpp0185169 XP_002023247.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]