SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0186639 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0186639
Domain Number 1 Region: 442-604
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.57e-65
Family A middle domain of Talin 1 0.0000343
Further Details:      
 
Domain Number 2 Region: 613-735
Classification Level Classification E-value
Superfamily I/LWEQ domain 9.02e-52
Family I/LWEQ domain 0.0000716
Further Details:      
 
Domain Number 3 Region: 2221-2413
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.66e-51
Family I/LWEQ domain 0.00013
Further Details:      
 
Domain Number 4 Region: 705-830
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.49e-40
Family I/LWEQ domain 0.0002
Further Details:      
 
Domain Number 5 Region: 1773-1904
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.77e-34
Family VBS domain 0.00033
Further Details:      
 
Domain Number 6 Region: 1157-1293
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.29e-33
Family VBS domain 0.024
Further Details:      
 
Domain Number 7 Region: 253-343
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-25
Family Third domain of FERM 0.0000596
Further Details:      
 
Domain Number 8 Region: 175-252
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-16
Family Second domain of FERM 0.0000693
Further Details:      
 
Domain Number 9 Region: 1015-1140
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000000424
Family alpha-catenin/vinculin 0.023
Further Details:      
 
Domain Number 10 Region: 884-984
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000785
Family I/LWEQ domain 0.0053
Further Details:      
 
Domain Number 11 Region: 1938-2063
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000141
Family VBS domain 0.013
Further Details:      
 
Domain Number 12 Region: 1423-1483
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000608
Family I/LWEQ domain 0.008
Further Details:      
 
Weak hits

Sequence:  FBpp0186639
Domain Number - Region: 1633-1730
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000667
Family alpha-catenin/vinculin 0.03
Further Details:      
 
Domain Number - Region: 1515-1587
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000785
Family alpha-catenin/vinculin 0.056
Further Details:      
 
Domain Number - Region: 83-134
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00186
Family Ubiquitin-related 0.056
Further Details:      
 
Domain Number - Region: 1338-1444
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0654
Family FAT domain of focal adhesion kinase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0186639   Gene: FBgn0160124   Transcript: FBtr0188147
Sequence length 2787
Comment type=protein; loc=scaffold_23:complement(149014..149287,149351..149985,150226..150897,151387..151902,151977..152093,154982..155172,155290..158766,159053..160124,160183..160299,160693..160781,161437..161525,161591..162094,162157..162235,162679..163074,163137..163272); ID=FBpp0186639; name=Dper\GL22532-PA; parent=FBgn0160124,FBtr0188147; dbxref=FlyBase:FBpp0186639,FlyBase_Annotation_IDs:GL22532-PA,GB_protein:EDW30056,REFSEQ:XP_002024608,FlyMine:FBpp0186639; MD5=1a02a4e851cdab2ec558b519d1274916; length=2787; release=r1.3; species=Dper;
Sequence
MSTLSLRIQLEGGRVTKTIQFQPNTTVFDACKIIRDKFAEAVQGQPSEYGLFISDEQNQQ
GVWLEAGRTLGYYILHNQDTLEYRRKLRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKRKIMEKDRDAKWKVSAEAQTDDETCE
FAGIQVHIQFGPHNEAKHKPGFLDLKDFLPQSYVRVKGIEKKVFVEHKKHSDLSEIDAKV
LYTKTARELPTYGTTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDERTKEILISWPLTTV
RRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEG
STMVEESVAPSKATFLQHETNRVEQLNVESLAHPGIMRPYDGERSFTQNEVQTVQYGAFV
GQVNHAHQPPTTKEVRISSVNLTEPQRALLGYISAGQDVLIRADEELRTKAPIQELGSDL
RSIEWRENTLDTSKQAVSSHVATMSAATAQIITASQPDEVDTEAISASVSQIAQTIPEVT
REVRLIAALMENDTNGDQLLEAARNLCNAFSDLLKAAEPESKEPPQNLINAASRVGEATT
HVLSSIAEEEVPENRDLHDMLLALAKAVANTTAALVLRAKNIAASCEDEQARNRVIGAAS
QCALATSQLVACAKVVAPTLHNAACREQLEAAARNVARAVNSLCEVCNEASNDPKLKADL
LAAARDVSKSLTDMLEHVKLSSRENASRTSTELSPVENVIIGTDILVSTHDPQEMVRHAR
TLGKTTAQLIQSIKGEAEQQQDMDMQRRLLSAAKQLADATAKLVEAAQRLRRAAEELREI
TTTAANTPAMKRSLIQRLEYCSKQAATAATQCISAAQNAVQHSQDHQTKESLLQDCKRVA
DTIPRLVTSLKTTRAQPDEPHAQLNLIEAAEQFIEPALQVSKSSRALQPTVTDIPSATQL
SKSALHLGQSVSELHSVAQRARDACGGQELESALEAVRKLHDVLDDTRQAALAGQLRPLP
GETVENTADELRKSAKNVGIALSQLLSSVLQNQRSYAGAAGRDTALALGDFTKSVHGVAA
TTQNPAIIDCADDVVTSSTRLIEQAQRTLQGISDPQALTQAGRDVTGALSATVDCIPGQR
EVDVALRNVSDLSEILSMSEFPPSGRPYATLQSELKQVAEHLSSSGGQIVVSYASPALLA
ETSQNFAANYRDLLSVSMEMAGQTQEDSVRSQIIECLRHVSTQSCSLLSTAKSIAADPGQ
PNAKNLLHAAARGVTESINQLVDASIQSAPGQKECDNAMRNIEALRRMLDYPHEPINEQG
YFDCVEQATGKSRNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQAAYLIG
VSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSAKPQMISALTVIAKHTSYLCSI
CRQASMNTSNPVAKNEFIVLAKQVATATSDLVQAIKAIEEQPQGGSRERLVEPLLEAVKA
VRQYASSPEFISIPAKISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALSPDNPPVWQ
QLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAVNAQGLSQRR
DNNLHGFSGQTLNSAAELVDKLEPIRVAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTH
IVHSQQQMSLINQTRSVVESAITLVQSAKDSAGNPRATHAHPRLDEAIDGTREAIQELQQ
TVEKINAETGIVTGLMEQINRSITRLTDKRQSLLNASYSDTFVDYQTRMVARAKEIASLA
NEMNAKSSVEPAALPQLAIDMTQHYQQLTQDSVGASTTTSSQDVGMRIRTTVIDLGRSVT
SMIQSSAGGARPNDVGAQKDIARNAREVSEKVAQVLAALQAGSRGTQACINAAHTVSGII
GDLDTTIMFATAGTLHSEGDGSFADHREHILQTAKALVEDTKVLVTGAAGSQDQLASAAQ
NAVSTITQLAEAVKRGACSLGSSQPDSQVMVINAVKDVASALGDLINCTKLASGKSISDP
SMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVEAISQEIRAMQAPPPVGST
QVGPEDLIRVTMNVTAATAKAVAAGASNLQADIVSAANLGRRAISDMLIVCRSVAWNCAE
TEELRVRTLEAGTSVGESYRDLLNGILHNCSADDRMHLSRRVAKCVTDLVAMARLLKGSD
WIDPEDPTVIAENELLGAAASIDAAAKKLASLRPRRQADVKIELDENMKFDEMILEAAKG
IMAASAALVRAANAAQRELIDQGKVARRPLTSSDDGQWSEGLISAARLVAAATHSLVEAA
QNLVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIKSTDNLV
HAAQQGLEAEEEHSLKINTSMVDGMAQEINARSAVLRKEKELEEARQRLKHVRQAQRYAK
NPQGFTTDESDTEYAYGTLNKSQNNTLGRSGYYASGEIPSSPSYFSGGGGSSSQQKHHYN
YASPQPQHFHHPGAVSPPPANYPGMDDHDTIGDFPPPPPPLSTTISNMQTATSGHSFRPN
PKLTANAVPRPYPGSPGGSNGLSSAPTGVGLTPTNANYQHSFESSSTKTQNSSSSAAAPA
PAAAPAPPAVPQKPQVNRNLEACVQDLHDKTFGQGGVVQLTGGNGYPGQSYEGYTSRYET
RNFDKSANSNNTTSSSEQQQQQALVKPLESSFSQMTLNTDGGKISIVDQGSERLTSMTQR
VMERKSFTTTTESRSETKTEKHSFRLE
Download sequence
Identical sequences B4H179
FBpp0186639 XP_002024608.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]