SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0188277 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0188277
Domain Number 1 Region: 600-659
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.83e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000312
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 317-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000012
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 653-710
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000223
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 517-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000156
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 456-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000432
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 571-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000547
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  FBpp0188277
Domain Number - Region: 399-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000999
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number - Region: 1238-1266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00645
Family Classic zinc finger, C2H2 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0188277   Gene: FBgn0161760   Transcript: FBtr0189785
Sequence length 1267
Comment type=protein; loc=scaffold_0:join(6238176..6238516,6238573..6238956,6239016..6239307,6239393..6239838,6239912..6240626,6240689..6242314); ID=FBpp0188277; name=Dper\GL24170-PA; parent=FBgn0161760,FBtr0189785; dbxref=FlyBase:FBpp0188277,FlyBase_Annotation_IDs:GL24170-PA,GB_protein:EDW24484,REFSEQ:XP_002013498,FlyMine:FBpp0188277; MD5=757c02f9bb43b00fc174a7283802f183; length=1267; release=r1.3; species=Dper;
Sequence
MNHQNYGGIQWIQQHPAASDSGVDILVGDGVTPDGYHLVTDEATGEDLDHMAAENLIFMA
RDGQLSEIIAGGNAVIVTADGHGVTYADSFDDDAQVVTEEVITDDWVQHQGAERVEIAAE
QIAGNGSSQELLDMEQDEYTALRPYPCDFCSRRFKKKSSLNTHMLAHQNDRPHLCKLCGS
RFSRRAELISHFKAHAEAQDAADAEAAAATSIKFEHRPMDDHYYEHEWPLYQQDQDAEDQ
QHYRRCSSADARTDQSPEAKGGSSLQIAISDKTEAPEMQDYMQSEPMQAVVTTSTAIEPP
PKADLPQPNYPVLDDSKPFVCQQCGLAFAREKALFSHTKNHRVDSPFECNQCQEMFWDNS
SLLEHQKTHQFEESNSEYDPASGDDSVSESEPDQLYGDFYCSECGICFHRQDLLRRHAKC
HFQQPDASNFDQKPIVGEVGVTDEVIAGDAENAKDDAAHRCHTCGKCFPNSVALSAHAEI
HARFPLFKCVLCGVSFYEEQAIKRHLHSRHPNELKANSCVLCGKECRDRKALIKHAWDHS
REKCHSCSKCGKNFHNKARLKRHMASHRDKSVVCEVCQEEFPDGRTLSNHRHSHSTTSPG
KLFPCLECGKTFGSRSSQQIHVRIHTGERPYGCRYCWKAFADGGTLRKHERIHTGEKPYA
CSVCPRAFNQRVVLREHIRSHHSGMDVTLGTYHCEVCSEDLSSSSELIQHLIKHSDTNTA
KQRQPVTGPRKYKRRRKLQPHEIAHMRAENKEDELLQEAEEYNSDLDICDFDVENVDQIF
EMAESPKKEKRKKGASKDPQAVANGTAKAVTDKSKMRYDSTSSHSDRMWEEKFLHDNQVS
LFQIDSLTAMNQQQSPLPTSTASSSSVQNTRRSSKQSQAQGQAKTAPPVEVKANPSASSS
STTASSSSRSRKKAGTSKAASSKSAAAGSSRPRMIHTEKAKVPKAAENSGTASGSTKKTR
GKSYITRTETSNLDLLSSSGSGKSRSTASNMVDDYEIISPATHPPNQISSSPLHIKQEQE
QQRVPMMYDDNLLIDAALLREKTYERFNPAIVNDLEEILRSPLKSEHNSRLRFTSESSTT
PQFLPGEEQNLIKIEPTSPDLREMVESQQRVTATTGNTPSSSSSSARTSRHLRQITANSP
RVGSKRSSSSRPDSASGAAAKKPTTSSSSSPVAAGSKTRSSEHSYLSYGVGVDSYNVNVP
ASANTADVSSAFFSISEVVSAADAADAAAKAAAASKSDRKKRSFECEMCSAIFYDRAQLL
DHVHIHI
Download sequence
Identical sequences B4G4D6
FBpp0188277 XP_002013498.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]