SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0190383 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0190383
Domain Number 1 Region: 968-1256
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-62
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0002
Further Details:      
 
Domain Number 2 Region: 221-343
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-21
Family Third domain of FERM 0.0069
Further Details:      
 
Domain Number 3 Region: 110-220
Classification Level Classification E-value
Superfamily Second domain of FERM 5.89e-21
Family Second domain of FERM 0.0014
Further Details:      
 
Domain Number 4 Region: 27-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000269
Family First domain of FERM 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0190383   Gene: FBgn0163858   Transcript: FBtr0191891
Sequence length 1260
Comment type=protein; loc=scaffold_5:join(6473353..6473437,6474449..6476411,6476727..6477612,6477672..6477890,6477955..6478131,6478194..6478517,6478576..6478704); ID=FBpp0190383; name=Dper\GL26276-PA; parent=FBgn0163858,FBtr0191891; dbxref=FlyBase:FBpp0190383,FlyBase_Annotation_IDs:GL26276-PA,GB_protein:EDW37458,REFSEQ:XP_002019262,FlyMine:FBpp0190383; MD5=a7924b9272bb666edbd1b1b780eec20a; length=1260; release=r1.3; species=Dper;
Sequence
MPFKFLKKCRQYNVTSKSLFVISVHHLLDTSSTVDCTISSESKGQECLDNVCQRLLIQQP
EFFGLRYLVRGKEDEYKWIDLERSLSRQLEKYAAGPKIYLRVRHYVTTGVRHLSDEATRF
YYFLQLKSDIYEGKIACDIRTAILLALYCRQAEYDSYQGDKQSKDYLKKSLVLPRNMQGL
ANDDSMLEGLIMEVLQQQATLAHLTQSRAEEMYIQCCQQLDGYGEERFSAKDTLGNDLLL
GLAINGMVVNADNGRQYFPWKDFHTVTIDKRTIKIEQNKLDGDGSIVGSFIFGEADTARY
FWKLCISQHKFFKRYIDTATPSSMGSAADVESSGHIGGDSVGYVDYDYGEAAAVEQLQQQ
QLQQQQQQHMQQQHQLQQQQQQQMLSSNMSLTTSANHSHSQLLGQSSSCLDLSNNNLHSS
NGMLHHNNNNEERERLKAMLPTYRPAPDYETAVQLKYRTPSAELHNVTLALAAPGNAYYA
GSQPDVHNPGAYNENVVFGHLTAHRYPDVAQPAAALHHHINLYQTQQQQQQQQQPAVGTA
QAYLELSRMHMMRHKAPPPYPVNRLSSSSTPDLAVATPRPLQGYRNYVSGSSPDLVSNRT
LLNGGQFVALAAGGHGGNMPTSSGATMLHHYIGHMGHSQPYLPPHGTFENLNMIEEQPSI
MSQLRQSAMSQAAAQAAVVATQSSPTLPPSGYRSSAPPPASSPQPPPVVVPPQKSTTPTP
LQRSVVNGSIEPIYENVPLPQRASGGSSGAAAAHAEAMRQRASSIQSAPPGVVPVPAVRH
ASSNNVVTVTVNAQPNNEITRNIQKFAADRAVSSEMQFLEPQAPQRAARAASAAPAIGAT
APPRQHRSTASLNKSTTVDVISPTGESLHQQFSAMNLSANTSASTSSMFNSTLDTTSSSA
ASKDGKRKKRWNFLARSKTPDKQKAATLGREKATSSNQHAKLAAKMKLAQDDLNLPNRWS
TGVSKPQPISGQYSKDKLCQILNEKLQDTQLFMEFERIPKRRENALYDCALLEEKRTEDH
DPNFLPYDDNRVRLTPAMDNRHGYVNASYISATVGTKQRFYIVAQSPQESQTMRIFWQCV
WEADVYLVVQLTEDMSYIPLSSQQRLEFGQFQVYQEFSQTTDRCTTSKLRLYHAPSRRYR
SVWHLQYADWAEQNCPRDVNHFLDFLEELNSVRLASTHEVPPGHNTNPPVLIHCLEGGGR
SGVTLTADLLLYTLDHNEDLDIPRVIGQLRHQRDSIIPSLAQYKFIYNLLITYLKRTRLI
Download sequence
Identical sequences B4GJE4
FBpp0190383 XP_002019262.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]