SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0191227 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0191227
Domain Number 1 Region: 41-111
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-17
Family PDZ domain 0.052
Further Details:      
 
Domain Number 2 Region: 146-190
Classification Level Classification E-value
Superfamily RING/U-box 0.0000103
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0191227   Gene: FBgn0164701   Transcript: FBtr0192735
Sequence length 501
Comment type=protein; loc=scaffold_19:complement(1773950..1775089,1775147..1775269,1775901..1775969,1776041..1776214); ID=FBpp0191227; name=Dper\GL27120-PA; parent=FBgn0164701,FBtr0192735; dbxref=FlyBase:FBpp0191227,FlyBase_Annotation_IDs:GL27120-PA,GB_protein:EDW28187,REFSEQ:XP_002023984,FlyMine:FBpp0191227; MD5=1fb91a1321d0bbd52bf0457ab3ecd726; length=501; release=r1.3; species=Dper;
Sequence
MKHTDRGTQPNAASTEGKAKDNEAATSSVRLLRIPRAAPSIENYGFHLTRSKWDPYPWVC
EVATGTPAALCGLKTGDCVLEVNGVDVLGLRVADVAKIVKSQKNCVTILCWNSGCEKDCD
KNSICCAPMPTSLRRLSVALESILRLIECPICNLTITPPAMQCQNGHVLCVDCRIRAERC
PVCRDFYTPRRALLAEQIYFTIANAFEMCRSEDKLRQKLFAGITKVPVAAVPQPAKTDAD
QSIWRKRRPLLPTNKFLTKLLEGRSDPLENLFDSNAATLLRTNSTDNFNASNGTIQSAEP
AEPTGTPRTTTMHPSHDEILGHLSLSTNDLRHATVKLKGQPNGESNVQVEGEGGEEESGS
SHSSSSVSFCYLPTRPQSSDSLLFIGKRRPIAPAQQPLHECMPPNVNESSSTLQLPAAET
PPPSVTLSKCGTENSPEEVVQTKPTSASLLYCCPCECTLRFDDELTLNQDKDQQRQQQKQ
QQKHQHQRGNCCCYKSAFRLL
Download sequence
Identical sequences B4GYR8
FBpp0191227 XP_002023984.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]