SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15806012|ref|NP_294713.1| from Deinococcus radiodurans R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15806012|ref|NP_294713.1|
Domain Number 1 Region: 45-175
Classification Level Classification E-value
Superfamily OmpH-like 0.00000000000000262
Family OmpH-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15806012|ref|NP_294713.1|
Sequence length 176
Comment cationic outer membrane protein OmpH [Deinococcus radiodurans R1]
Sequence
MTCFIRLRNRHASVAVMKITAKALAPVTLAAAFGLGTLAPHAQTPAQKVGFVNVDALFAA
HPGNKDVVALSDSLNKDATLTDTVNKLRAIDAKGASATAAEKQQREALLATYNAKTKPLN
DKTAQVETAIDKSLSDYAKANGFSVIMDRSIAQQSGLVIYADNSTDLTEAVKKTIK
Download sequence
Identical sequences Q9RVN8
gi|15806012|ref|NP_294713.1| NP_294713.1.55610 WP_010887632.1.45201 WP_010887632.1.61927 WP_010887632.1.86829 243230.DR_0989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]