SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15806421|ref|NP_295127.1| from Deinococcus radiodurans R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15806421|ref|NP_295127.1|
Domain Number 1 Region: 13-45
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000549
Family Type I dockerin domain 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|15806421|ref|NP_295127.1|
Domain Number - Region: 48-69
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00746
Family Type I dockerin domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15806421|ref|NP_295127.1|
Sequence length 73
Comment hypothetical protein DR_1404 [Deinococcus radiodurans R1]
Sequence
MQRELGLKAWTPXGAAARFSGADLNNDGVVDLADLAVLMENFGKTGALPGDLNGDRRVDD
ADLKLFSRQYTLP
Download sequence
Identical sequences Q9RUI2
gi|15806421|ref|NP_295127.1| 243230.DR_1404 NP_295127.1.55610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]