SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|347359972|ref|YP_388598.2| from Desulfovibrio alaskensis G20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347359972|ref|YP_388598.2|
Domain Number 1 Region: 386-568
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.89e-36
Family Histidine kinase 0.00000745
Further Details:      
 
Domain Number 2 Region: 8-125
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 1.57e-31
Family Chemotaxis protein CheA P1 domain 0.0012
Further Details:      
 
Domain Number 3 Region: 569-697
Classification Level Classification E-value
Superfamily CheW-like 2.49e-30
Family CheW-like 0.00024
Further Details:      
 
Domain Number 4 Region: 325-385
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000271
Family Homodimeric domain of signal transducing histidine kinase 0.0025
Further Details:      
 
Domain Number 5 Region: 186-348
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000129
Family Regulator of G-protein signaling, RGS 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347359972|ref|YP_388598.2|
Sequence length 704
Comment CheA signal transduction histidine kinase [Desulfovibrio alaskensis G20]
Sequence
MQLDVNSQAFMEEAQDLLTELESALLELEEQPGDTELVDRVFRAMHTIKGSGAMFGFDDI
AAFTHDVENMFDRVRNNELQLSREILDLTLACRDHIAYLLQCAGSGTQVDLEKGSALTAK
VRLMLGAGDQQEPADAAPAQTAQSADSSFDEEDGSRRFTYRIRFKPAPDIFLTGNNPLHL
IEELRDMGMLTTYVHTSALPSLAELNPESCYLWWDMLLHTSAGEQEVRDVFMFVEDECEL
SVQVVDSGDRIDSDEKYKLIGEILVERGDLKPEDLQRVLSSRQPMGKLLQQAGVVSEDSV
ESALQEQQTVRDMQQKRETSSEAASSIRVAASKLDYLVDLVGELVIVQSQIAQMVHERED
ADMLALSENLERLSDELRDATLGIRMLPIGTTFSKFRRLVRDLSADLGKEVDLVTFGAET
ELDKTVIERLSDPLVHCLRNSLDHGVEPPQQRVAAGKPRKGTITLGAAHSGGEVLITISD
DGKGLDRDRLLSKAVERGIVAPDAELSDKEIYALIFAAGFSTAEKVTSVSGRGVGMDVVR
RSIEELRGTIELTSEPGMSTVITIRLPLTLAIIDGLQVQVGEESYVIPLAPVEECVEHFG
TADSGRKQIINLRDEVVPYISLRKLFDVSGTPPEIEQIVVVNALGSRFGIVVDRVVGEHQ
TVIKSLGKVFKNVEGISGATIRGDGTMALILDLPRLVQSAISAR
Download sequence
Identical sequences Q30ZJ3
gi|347359972|ref|YP_388598.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]