SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DDB0202112|DDB_G0268310 from Dictyostelium discoideum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  DDB0202112|DDB_G0268310
Domain Number - Region: 65-104
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.0177
Family Inorganic pyrophosphatase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DDB0202112|DDB_G0268310
Sequence length 140
Comment |Protein|gene: DDB_G0268310 on chromosome: 1 position 577816 to 578337
Sequence
MEPLNDDIKFSFTDLDNLEVENSIKYLQDTQQKKDKLRNLFIQFPGIKKLALDLCKNSKD
GKEIHSFYNGIVQVGKGNNEKVEIKKKENIFLRFLKYFFNFGFFIIKTILFLYFIILVSG
NYEFLSKSLYLQNIMEIISN
Download sequence
Identical sequences Q55GG2
DDB0202112|DDB_G0268310 44689.DDBDRAFT_0202112 XP_647222.1.73096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]