SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DDB0233791|DDB_G0284265 from Dictyostelium discoideum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DDB0233791|DDB_G0284265
Domain Number 1 Region: 24-268
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.03e-90
Family Inorganic pyrophosphatase 0.000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DDB0233791|DDB_G0284265
Sequence length 279
Comment |Protein|gene: ppa1 on chromosome: 4 position 1798190 to 1799209
Sequence
MKNFFSFSKLTPHLKNIYHRNMTYTTKQVGETGSLEYRLFFLKDNKPVSSFHDVPLWVNK
EKQIVNMLVEIPRGTNAKLEIATKEYMNPIKQDVKDGKLRFVHDKYPFNYGALPQTWESP
EHTHPSTGAKGDNDPLDACEIGSGQGVTGEFKQVKVLGVFAMIDAGETDWKILCIDVNDP
IASQINSQEDIEKHLPGKINEVYTFLRDYKIPDGKGPNQFAFDGKLQSIDFSMKIIEETE
AEWKDLVGGKTKSSLSVVNTTLNDSNTVTADVAAQKLNF
Download sequence
Identical sequences Q54PV8
XP_638687.1.73096 DDB0233791|DDB_G0284265 44689.DDBDRAFT_0185935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]