SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DDB0191177|DDB_G0286357 from Dictyostelium discoideum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DDB0191177|DDB_G0286357
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.91e-23
Family Ubiquitin-related 0.0016
Further Details:      
 
Domain Number 2 Region: 222-289
Classification Level Classification E-value
Superfamily XPC-binding domain 4.05e-20
Family XPC-binding domain 0.00071
Further Details:      
 
Domain Number 3 Region: 146-202
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000143
Family UBA domain 0.0042
Further Details:      
 
Domain Number 4 Region: 273-341
Classification Level Classification E-value
Superfamily UBA-like 0.000000179
Family UBA domain 0.0024
Further Details:      
 
Weak hits

Sequence:  DDB0191177|DDB_G0286357
Domain Number - Region: 80-160
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.00247
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DDB0191177|DDB_G0286357
Sequence length 342
Comment |Protein|gene: rcbA on chromosome: 4 position 4412389 to 4414128
Sequence
MKVTIKNINKEIYVFEVNGDLTVAELKNLISEKHNQTPSWQTLIYSGKILEDKRTLESYN
ITDSGFIVMMIKKPREAPATTPAPSTTPAPSTTSAPTTTTTAEPTPTTSSTNNTSTTTPT
SVPTPTNNTPATPNPTPTTSSTPGSTSTTSPQQSSDFATGTELEATIKNITDMGFARDQV
LRALRLTFNNAERAIEYLVSGNIPAANDPEDEEEMEGGGGSGDNPFEALRNHPHFNLLRE
AISKNPSIIPGILQQLAQTNPALVRQIQENPNEFIRLFQGDGNPGGNPGQFTLQVTQEES
EAIQRLQALTGMDKSTVIEAYFACDKNEELTASYLFETADDE
Download sequence
Identical sequences Q54LV1
DDB0191177|DDB_G0286357 44689.DDB_0191177 XP_637729.1.73096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]