SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DDB0201554|DDB_G0269100 from Dictyostelium discoideum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DDB0201554|DDB_G0269100
Domain Number 1 Region: 8-223
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.87e-67
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 
Domain Number 2 Region: 459-563
Classification Level Classification E-value
Superfamily E set domains 1.27e-25
Family Filamin repeat (rod domain) 0.00046
Further Details:      
 
Domain Number 3 Region: 248-346
Classification Level Classification E-value
Superfamily E set domains 2.14e-25
Family Filamin repeat (rod domain) 0.00068
Further Details:      
 
Domain Number 4 Region: 529-649
Classification Level Classification E-value
Superfamily E set domains 7.34e-25
Family Filamin repeat (rod domain) 0.0000026
Further Details:      
 
Domain Number 5 Region: 629-751
Classification Level Classification E-value
Superfamily E set domains 2.47e-23
Family Filamin repeat (rod domain) 0.00000352
Further Details:      
 
Domain Number 6 Region: 350-446
Classification Level Classification E-value
Superfamily E set domains 2.8e-23
Family Filamin repeat (rod domain) 0.00055
Further Details:      
 
Domain Number 7 Region: 761-841
Classification Level Classification E-value
Superfamily E set domains 1.8e-17
Family Filamin repeat (rod domain) 0.0000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DDB0201554|DDB_G0269100
Sequence length 857
Comment |Protein|gene: abpC on chromosome: 1 position 4554019 to 4556699
Sequence
MAAAPSGKTWIDVQKKTFTGWANNYLKERILKIEDLATSLEDGVLLINLLEIISSKKILK
YNKAPKIRMQKIENNNMAVNFIKSEGLKLVGIGAEDIVDSQLKLILGLIWTLILRYQIQM
SESDNSPKAALLEWVRKQVAPYKVVVNNFTDSWCDGRVLSALTDSLKPGVREMSTLTGDA
VQDIDRSMDIALEEYEIPKIMDANDMNSLPDELSVITYVSYFRDYALNKEKRDADALAAL
EKKRRETSDASKVEVYGPGVEGGFVNKSADFHIKAVNYYGEPLANGGEGFTVSVVGADGV
EVPCKLVDNKNGIYDASYTATVPQDYTVVVQLDDVHCKDSPYNVKIDGSDAQHSNAYGPG
LEGGKVGVPAAFKIQGRNKDGETVTQGGDDFTVKVQSPEGPVDAQIKDNGDGSYDVEYKP
TKGGDHTVEVFLRGEPLAQGPTEVKILNSDSQNSYCDGPGFEKAQAKRPTEFTIHSVGAD
NKPCAAGGDPFQVSISGPHPVNVGITDNDDGTYTVAYTPEQPGDYEIQVTLNDEAIKDIP
KSIHIKPAADPEKSYAEGPGLDGGECFQPSKFKIHAVDPDGVHRTDGGDGFVVTIEGPAP
VDPVMVDNGDGTYDVEFEPKEAGDYVINLTLDGDNVNGFPKTVTVKPAPSAEHSYAEGEG
LVKVFDNAPAEFTIFAVDTKGVARTDGGDPFEVAINGPDGLVVDAKVTDNNDGTYGVVYD
APVEGNYNVNVTLRGNPIKNMPIDVKCIEGANGEDSSFGSFTFTVAAKNKKGEVKTYGGD
KFEVSITGPAEEITLDAIDNQDGTYTAAYSLVGNGRFSTGVKLNGKHIEGSPFKQVLGNP
GKKNPEVKSFTTTRTAN
Download sequence
Identical sequences P13466
XP_646669.1.73096 44689.DDB_0201554 DDB0201554|DDB_G0269100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]