SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DDB0220121|DDB_G0284333 from Dictyostelium discoideum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DDB0220121|DDB_G0284333
Domain Number 1 Region: 382-697
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-113
Family BEACH domain 0.0000000468
Further Details:      
 
Domain Number 2 Region: 849-1153
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.3e-51
Family WD40-repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 293-384
Classification Level Classification E-value
Superfamily PH domain-like 8.2e-21
Family PreBEACH PH-like domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DDB0220121|DDB_G0284333
Sequence length 1154
Comment |Protein|gene: lvsF on chromosome: 4 position 1946519 to 1950085
Sequence
MFSKNINKVRFNLTLMDEGEYYFDDYSAIFYPPSNTEEESWQKRIAGRILVCSSSMFFEP
DDSKLPIMKFPYKDMSSIGAWLNSLSSAPPAHLPTPQPIPQSILSPSKPTPTPTPPIVVE
QPSPTRSAFSRLLSFSSLTSKVTTPTPPTPTPTPPTPQPTSIAPTPTIATNPYTSFSVSP
NPPSPLLSQLFEQAKPSFLASKGDIFYVKSSQVIEMKENSRNHPYIFKQYNNIDFKFSFN
YVKQNIVLDVMKVFHNYSGKEKIQRDELIKQMVEDRENKIFFDITQLVDMNERNILELKC
SKISPLVENPGRLLITNARLYFQPMNNIEENRLKNYSLQSIIRVLQRRHSLREIGLELFF
DDGSSLFLKFNNTITRNQVYDLLVKHLCTNIMHINEQANYLLKWQNGIISNYDYLLYLNN
LAGRTFNDLTQYPVFPWIIADYQSTTLDLNRNETFRDLSKPIGALNPTRLATFQDRYHQI
PDDQPKFLYGTHYSTPAYVLYFLVRQVPEYMLRLQNGRFDSPNRMFYSIEETWNSVLNST
TDVKELIPEFYKPSFESSSSSRNGGGGDDDDNFENGIFLTNSENLPLGIRQDNNVINDII
LPPWASSPKDFISKLHQALESEYVSQNLHHWIDLIFGYKQKGEEAVRANNLFYHLTYEGS
IDIESITNPFEREGMEAQINEFGQTPRQIFKTPHPQRLPQQLRNQNLKIELSDLEQNINF
IFDELNNCNINELNNDNDNNLNNNNNNNNNNNSNSNSNLNNNYIDSNINNNINNIENINS
LNNENNENSNDKKNNSNSNSSDNIKNSNGFENNDNNFNNENENLNDENENLTFLGEERNN
SNNWGSLNFLKFNQNIKLHKDKISALYLSNNSETIYSVSLDSCLKIYSLKEKRQIRSLNL
CNLALSSFQLSKDEKYIIIGSWDNNIYVYSVGNGSISYSIPGHSDAVSCLKLHNNNILVS
GSWDSSVKVWRTHRQSNGAISIEKTPIADFVDSDTEIRSIDISSNGTIFCAGSSDGYLYF
YDLLTLQLIRRISCFFDELVCIKFTPDGSRIITACIDGSVKLIGIEGSEIFSFKVKGEIH
CLDSDGSSLIIGTDRGLCLWSLTTGTEIKDSISPFLSQSSNESIHSLNVSINQSSNKPIL
LTGTEAGSISIWQQ
Download sequence
Identical sequences Q54PP7
XP_638607.1.73096 44689.DDB_0220121 DDB0220121|DDB_G0284333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]