SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DDB0229895|DDB_G0293834 from Dictyostelium discoideum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DDB0229895|DDB_G0293834
Domain Number 1 Region: 177-279
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.83e-28
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00036
Further Details:      
 
Domain Number 2 Region: 14-122
Classification Level Classification E-value
Superfamily PH domain-like 5.26e-26
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DDB0229895|DDB_G0293834
Sequence length 399
Comment |Protein|gene: wasA on chromosome: 6 position 3376698 to 3378105
Sequence
MGSPTISDQEKSQVAFIAGSSSDIHSTTVARLYEGRQGRWEFMAVGIVSVVSNRVDKTNY
IKVFDLKANYRIIFEQEIYDTFEFQKQRDFFFAFEGDSCVYGLSFADVTEAAEFYGQLLN
CKQGNIGKTAAINPNTSSTKITASTPAPKVEKKKEKKGFMSKFFSSEEKDLEISAPTNFK
HESHIGWDPENGFDIKNIPPDWRKLFQSAGIKKSELKNAETAQFIVNIIGEQMVGGSAPP
PTQPGRSAPPAPPSSNQPGRSAPPPPPSVGKSAPPPPPPSHKTPAAPPSGGGAPPPPPPP
PPPSSGPPPPPPPMASAPPSSGGGGASGGGRNDLLASIRSGASLKAVDKTNPLPDIQSLG
NEGSRSLADTLAAAMANRRGGMREDDEEDDDDDDEWSDY
Download sequence
Identical sequences Q9GSG9
DDB0229895|DDB_G0293834 XP_628937.1.73096 44689.DDB_0229895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]