SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DDB0346866|DDB_G0276437 from Dictyostelium discoideum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DDB0346866|DDB_G0276437
Domain Number 1 Region: 67-166
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000000000607
Family Ricin B-like 0.022
Further Details:      
 
Domain Number 2 Region: 200-297
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000103
Family alpha-D-mannose-specific plant lectins 0.0013
Further Details:      
 
Weak hits

Sequence:  DDB0346866|DDB_G0276437
Domain Number - Region: 328-385
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 0.0198
Family MHC antigen-recognition domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DDB0346866|DDB_G0276437
Sequence length 626
Comment |Protein|gene: DDB_G0276437 on chromosome: 2 position 6910190 to 6912323
Sequence
MKQLLLIISLIFICLNNISICQVYPTDEIKDVRGYCLTSPKNVGEKITIENCIHSQTTNN
DQQQRLQQLWTFSLGNKNYPTLESLSGLCAQISNNTLIAIQCTTTYSSNSFFSARYIDGA
FLIKSIKSQSCLQSSFKIGESPFFTNNCDGDENQKFFIDLTFKEFSPVYNQNKIPLTMSL
SNVNYFLDSNDVNSQSGVYRGWERELPGLIVKFNTDCTLTISEGNSVVWKNVESSPIGCS
PSAVLKMQIDGNLCTYIHENNPNANWCSMTQGLKGRYFNILPYGSYGKKWGLIIQSEQGK
MVWGKWGESIYPDANYNLIPGSFIDEKLDSNNRITGGLEFITNGRDYLTLDYNTGLSYYI
GNPTINSRKLVWSSQTSVNTMFQKYGFPLTLKIKNDSALVTTQYFLEGQSNWVDVPIWIT
RAPIKGSRFIHLPILNQNDMDNWGWVIQNKGLKIIYGHFNSQPTIISGSNNFLNGGLKST
LNSSKLLYSDVLNFGLRSDGVLEFKNLITGELLYPFSYSSVLIPTSINGIIQCPSKQYLG
YWDSDNNFGVKIVGCQLYRDTCKKTDSTSCAKQGIRTQNDNDKCFTYYKFLPNSLPFGST
TLVIQYGLPEIMFIGYDNILVSNYLF
Download sequence
Identical sequences Q86HW3
XP_643128.1.73096 44689.DDBDRAFT_0167064 DDB0346866|DDB_G0276437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]