SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0224703 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0224703
Domain Number 1 Region: 473-582
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-25
Family SH2 domain 0.00000555
Further Details:      
 
Domain Number 2 Region: 585-625
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000183
Family SOCS box-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0224703   Gene: FBgn0197572   Transcript: FBtr0226211
Sequence length 643
Comment type=protein; loc=scaffold_12963:complement(8391136..8391445,8391651..8392560,8392680..8393391); ID=FBpp0224703; name=Dvir\GJ10286-PA; parent=FBgn0197572,FBtr0226211; dbxref=FlyBase:FBpp0224703,FlyBase_Annotation_IDs:GJ10286-PA,GB_protein:EDW63970,REFSEQ:XP_002051815,FlyMine:FBpp0224703; MD5=f6d24f07f80c2aef3fe228db984bb0d3; length=643; release=r1.2; species=Dvir;
Sequence
MGHQLSKRTDLIVASQSQSQSRTERNSRSSRQTDLEQETQQPDIAEAGEKATPIAEEALA
EVRQIIIKIQLAKMEGGNDSAEQQQQEQQQFPLSEGVAMSADALNANEQILSVAVGAAAG
TGASRTAGSSTEAPKTNERQLVNNNNLAGSVASASAAVRMLQLHDHDHDDNDDDVVVVDD
AEDAELEMAISSLLRRRRRSSSGGGVGGVGAEGVEYCEVLEPQPVSDMLSSGAQRAQAPS
GSNSNSGNSCCRSRSSKALATGAAGTVTSKRRCCKCKCRDALRGLRGMLESSTGSASAAA
AAAKDKKEPAAAAVAAPRSKTRSSADRRSTPPTLSASSGGAAAVNRLQTHRQRNSVAVAE
PSQLAIWAAPAMGDVIIRISSQPQPQFLMESAAATAACNNCNANTPVVTMSHQGLRLVAS
THPDPAAAAAVAAAAAGVLPALTIEQPRAAVPLNAYGAGVTVHSQIDFMHCLVPDLERII
NSSFYWGKMDRYEAERLLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHARIEQSGHKF
SFDCHDPCVFAALTVTGLLEHYKDPSCVMFFEPCLTMPLHRRQTFSLQQLARATIVSNTT
YDGINQLELPGRLKSYLKEYHYKQKLRVKPCDAHTPAPYYANI
Download sequence
Identical sequences B4LTR9
7244.FBpp0224703 XP_002051815.1.90633 XP_015027967.1.90633 FBpp0224703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]