SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0224728 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0224728
Domain Number 1 Region: 75-142
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000855
Family SAM (sterile alpha motif) domain 0.05
Further Details:      
 
Weak hits

Sequence:  FBpp0224728
Domain Number - Region: 150-218
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0262
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0224728   Gene: FBgn0197597   Transcript: FBtr0226236
Sequence length 352
Comment type=protein; loc=scaffold_12855:complement(5155270..5155583,5155683..5156136,5156231..5156521); ID=FBpp0224728; name=Dvir\GJ10311-PA; parent=FBgn0197597,FBtr0226236; dbxref=FlyBase:FBpp0224728,FlyBase_Annotation_IDs:GJ10311-PA,GB_protein:EDW59400,REFSEQ:XP_002056288,FlyMine:FBpp0224728; MD5=fc7dbc86b40eeb6e5198c4f98452fb03; length=352; release=r1.2; species=Dvir;
Sequence
MPYLYGITDTKLDTKKQKKRVKKQITVPPLKYRTIDLLERPEKYDRETCPIQFRVTPATL
VEQCVSVVDKLPLPSVYEWNDKNIRLWICRLGYPQYMRTFRVNMIWGRKLLLLDADALSA
MNIKDFDHIRHITYTIRMLFHFELTKFSHSISLPDEKPNELYLLWHTQTGLNYDAVRRSD
LYRRMQLIRERSPNLDHWDMLEMWLRRERERKYSELIALVPRYKLYPCTKTPAESTNQTI
LKTSRELDVNCMPPCDCFWTMRDTSLPWRLHCLGVAKPTGTNTKSKWLAHETKCQDCVPP
CECRWLSRHYLTGTVLTCLKKHFPVKFAPTFDSRHDAQVPPGMVECWTRFSI
Download sequence
Identical sequences 7244.FBpp0224728 FBpp0224728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]