SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0224732 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0224732
Domain Number 1 Region: 586-727
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-44
Family Phosphotyrosine-binding domain (PTB) 0.0000256
Further Details:      
 
Domain Number 2 Region: 448-570
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-22
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0224732   Gene: FBgn0197601   Transcript: FBtr0226240
Sequence length 737
Comment type=protein; loc=scaffold_12855:complement(4881241..4883454); ID=FBpp0224732; name=Dvir\GJ10315-PA; parent=FBgn0197601,FBtr0226240; dbxref=FlyBase:FBpp0224732,FlyBase_Annotation_IDs:GJ10315-PA,GB_protein:EDW59390,REFSEQ:XP_002056278,FlyMine:FBpp0224732; MD5=cacdab64f4c611469b18f3c8d7f6f3b8; length=737; release=r1.2; species=Dvir;
Sequence
MRSPYEDSAAVSTDNKYHTSYSYNSHTNNNNNNYHKNFNGNGNGIPYHARENSLPFSYGN
AKTATPLRKTPTPTRADSFLDFDFGLGSNSNSNNNYNNNNINNNNDSSSGSDMIKPQPRL
TSPLLVRKTLGSRVNANGNTNGSKMNTNSNTNTNTNTISNTYHYGSAANVTPPRVDFEQQ
LRERRDKVYNEYREREKERELERELERELERAAARVPPTPPLRRQSNGLSHSKYNYDFEF
NLNLDDINERSSLPAPAPVPAPAPYNTRNIEYRQDMDVPDGAISGNSRRLESTIVERNYH
TINRSSHNNSNSSSSSSSKSNNNNNNYYHSLERPPMEVTYKQLVEPQMEQQAHIYGQSQL
HLETHTRNRRDLSPIYAISTKRNTAAAAPNSNGQQQADYLLTPSPTSPRPETPAFPVTPR
TPFGSSTLQRASPTTESIYQTMASARQRLNSAPSPTFEVAADLVKFARNSAKFWYKPMLS
REDAIALLMNAPPGTFLVRDSTTYANAYGLVLRVAQPPAGSHELVRHFLIEPTQRGVHLK
GCDNEPTFTSLSALIYEHSINKLALPCLLLIPEADVVPGLASTTAAQQQLLTHGAATNVL
WLYSCDTESLTGNEAIRKAIRLMYAQKPLPTPTEVHFKVSGQGITLTDNTRKKFFRKHYT
ADVISHCAIDPENRMWSNNPNESDKKTIFAFVARRSHSSKDNQCHVFCDLSVAQPAAAIV
SFANRTLPTEKQRNYVL
Download sequence
Identical sequences 7244.FBpp0224732 FBpp0224732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]