SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0224781 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0224781
Domain Number 1 Region: 278-382
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.87e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 111-166
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000314
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.069
Further Details:      
 
Domain Number 3 Region: 26-82
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000785
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0224781   Gene: FBgn0014842   Transcript: FBtr0226289
Sequence length 761
Comment type=protein; loc=scaffold_12855:complement(3883574..3884865,3884940..3885046,3886338..3886537,3886604..3886771,3886901..3887002,3887228..3887397,3889107..3889301,3890174..3890225); ID=FBpp0224781; name=Dvir\sim-PA; parent=FBgn0014842,FBtr0226289; dbxref=FlyBase:FBpp0224781,FlyBase_Annotation_IDs:GJ10364-PA,GB_protein:EDW59291,REFSEQ:XP_002056179,FlyMine:FBpp0224781; MD5=9f6ec8d82c91d32dd1874b776cb30424; length=761; release=r1.2; species=Dvir;
Sequence
MTNHRRVRKDCYESRLHDIAKTCAMKEKSKNAARTRREKENTEFCELAKLLPLPAAITSQ
LDKASVIRLTTSYLKMRQVFPDGLGEAWGSSPAMQRGATIKELGSHLLQTLDGFIFVVAP
DGKIMYISETASVHLGLSQVELTGNSIFEYIHSYDQDEMNAILSLHPHMHQHPLAQTHTP
IGSPNGVQHPAAYGHDRGSHTIEIEKTFFLRMKCVLAKRNAGLTTSGFKVIHCSGYLKAR
IYPDCGDGQGSLIQNLGLVAVGHSLPSSAITEIKLHQNMFMFRAKLDMKLIFFDARVSQL
TGYEPQDLIEKTLYQYIHAADIMAMRCSHQILLYKGQVTTKYYRFLTKGGGWVWVQSYAT
LVHNSRSSREVFIVSVNYVLSEREVKDLVLNEIQTGVVKREPISPAAQAAAVAAAAASAS
AAAAAAAAAAAASVSIGATCVAAQQPVTSTPALSVSPKLDPYFEPELPLAVQPPPPNAVT
PVPTNNNNNNNNNNNSSSGVWHQQHAPLHQQQAGSMDHDSLSYTQLYPPLNDLVVSSSSS
AGGGTASSAGGGSSASASSSGVYSTEMQYPDTTTGSLYYNNNNHYYYDYDATVDVATSMM
RPFSANSNSCSSSSESDRQLSTGNASIVNGTSPSQTTYSDLSHNFELSYFSDNSSQQQQQ
QQQQQHLLEHQHLQQQQQQLHAQQQHPQQQHAHQQYQQQQQYGMHQQQQQQQQQQQQRVV
SDFAESFKSVNAAAAAAVAATPHYTSVIVEPQHYIPNDFVH
Download sequence
Identical sequences FBpp0224781 7244.FBpp0224781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]