SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0224871 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0224871
Domain Number 1 Region: 7-68
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000204
Family Tachycitin 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0224871   Gene: FBgn0197734   Transcript: FBtr0226379
Sequence length 767
Comment type=protein; loc=scaffold_12855:complement(2458853..2460594,2460684..2460920,2461007..2461220,2466141..2466251); ID=FBpp0224871; name=Dvir\GJ10454-PA; parent=FBgn0197734,FBtr0226379; dbxref=FlyBase:FBpp0224871,FlyBase_Annotation_IDs:GJ10454-PA,GB_protein:EDW59127,REFSEQ:XP_002056015,FlyMine:FBpp0224871; MD5=65c53dfa683691347eeee28840197566; length=767; release=r1.2; species=Dvir;
Sequence
MPKTKFTCRDKILGGYYADPETQCQMFHVCVKLPGVGVQDYRFLCPNSTAFDQELQICAN
WADVDCDKAPAYYDGNNLNDLYRGGEESKSPNQGEEEEGTFHLQRAESGDVRRSKENRGD
QKSRPRHNYGQTASSGSADSTQTSRRPITSYYTPTTTTTTTTTSTERSYYNNNYNNNNYN
NNNDDSKQDIDDIFKGSHSSHFFANRHGGREFDEEPAVVARSRPNDFNDYSRKTTEAASK
TRATPTRAQRTSSQIPAFTATTTTTSSTSAPTSKSLKKITLHAAYNTGFPDYTQHPKSST
PSSVAPTAGTTPRLGSGITSRFSFGLNDYQTQERIQPTTYNPNNGYRFKSTELPASSTKL
TGKNAQDFDKETTRRHNKPTVAARKQKLGPQESNYINHNEFAELPKAKLQQPQPFQATSG
ATRKPAQLEPQYQRPRANGQQLTRVGSQEPAPFKSSSAAKPRTFTSRGSITYKATTQRYA
DDEFYYPTTTSTTANPSKKLSTQAYTPTTFKPTTYKKPYETNYYQAPQTLRPSQSASPKK
TSAVTPQSVPTTTANPYYNVDEDDGQYHPELYENDFPRNRFKFLRNRSTSSGTTTSTTSA
PAVSRQPHGFHQAHSHLRSQQQSAYQKEREQEQSDLSDEDELFKTAQSLNFGAASINKLR
ADIYKAEKTSQQYNSQYSPQLAPSSPKTTAQTSSSPTTTTTTTTSTTRRPTTTTTTTTTT
TIRPTTSSALELKKSAKSKKEDKKSKSKRPPHADEDTSYDYAYYDTD
Download sequence
Identical sequences 7244.FBpp0224871 FBpp0224871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]