SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0224876 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0224876
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000922
Family SAM (sterile alpha motif) domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0224876   Gene: FBgn0197739   Transcript: FBtr0226384
Sequence length 200
Comment type=protein; loc=scaffold_12855:complement(2359447..2360049); ID=FBpp0224876; name=Dvir\GJ10459-PA; parent=FBgn0197739,FBtr0226384; dbxref=FlyBase:FBpp0224876,FlyBase_Annotation_IDs:GJ10459-PA,GB_protein:EDW59119,REFSEQ:XP_002056007,FlyMine:FBpp0224876; MD5=9b19300fd14bb677f2b300817c179b02; length=200; release=r1.2; species=Dvir;
Sequence
MCTKKVREWLVLLTMEKYVRCFTEHGYISIAQCQQILTSDLIMLGIDNPTHRQLLLTGVQ
LLINSPNLFVCPEPCELHVSCADQDLAEDFLDTCKIDLQAIDSSFNTPQHGHSKNKFGFL
ARTKRERKSKSKKSKETLCSVNIKANFTCVACPHLQFGQLYELDEHIAALKESKDSSASQ
HKYGDLITNVQEATPIILIE
Download sequence
Identical sequences B4M643
7244.FBpp0224876 XP_002056007.1.90633 FBpp0224876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]