SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225201 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225201
Domain Number 1 Region: 115-234
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000838
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.049
Further Details:      
 
Domain Number 2 Region: 9-67
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0079
Further Details:      
 
Domain Number 3 Region: 258-312
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000157
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225201   Gene: FBgn0198056   Transcript: FBtr0226709
Sequence length 323
Comment type=protein; loc=scaffold_12855:join(3485543..3485753,3485824..3486041,3486105..3486329,3486401..3486567,3486635..3486785); ID=FBpp0225201; name=Dvir\GJ10784-PA; parent=FBgn0198056,FBtr0226709; dbxref=FlyBase:FBpp0225201,FlyBase_Annotation_IDs:GJ10784-PA,GB_protein:EDW59265,REFSEQ:XP_002056153,FlyMine:FBpp0225201; MD5=97ede0df73f1a3c374891bb967c4eeeb; length=323; release=r1.2; species=Dvir;
Sequence
MQLNSICRNNEKRKEKSRDAARCRRSKETEIFMELSQALPLKPDDVNQLDKASVMRITIA
YLKIRQMLEFVPNIRELIDMADGDATATLVKPKVENDSEDWLKSAEASQLLKQTMDGFLV
VLSNEGDVTYVSDNIIDYLGITKIDTLGQQIWEYTHQCDHAEIKEALNLKRNGIADKIKD
EQLIESGVSTHHRDLFVRMKCTLTRSGRSINIKSASYKVIHITGHLRVNSKGERVLIAIG
RPIPHPSNIEIPLGTSTFLTKHSLDMKFTYVDDKMLALLGYLPGDLLETSLFDCQHGADS
ERLMATFKSGKCATREICMSLAH
Download sequence
Identical sequences FBpp0225201 7244.FBpp0225201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]