SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225203 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225203
Domain Number 1 Region: 101-197
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000162
Family SH2 domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225203   Gene: FBgn0198058   Transcript: FBtr0226711
Sequence length 210
Comment type=protein; loc=scaffold_12855:join(3618427..3618682,3619446..3619822); ID=FBpp0225203; name=Dvir\GJ10786-PA; parent=FBgn0198058,FBtr0226711; dbxref=FlyBase:FBpp0225203,FlyBase_Annotation_IDs:GJ10786-PA,GB_protein:EDW59272,REFSEQ:XP_002056160,FlyMine:FBpp0225203; MD5=d6d31662fc2d764105651019b829857e; length=210; release=r1.2; species=Dvir;
Sequence
MCWCARVYWTVLHNLFARFYNSLTERGYRQGCCACCCGGYSRQAGDDDGDVDVDADADSD
AGKRVSESIVDDDQQRSAPHDYVIVDDADANYVEIEQRQIETEPYYFTVDRDMAERMLCG
REDGACLVRPFKATDVCIKYIVSICADRQFYHLFVRQIDGRQRFAIGQSKPHERHFASPC
EIIEFYVEHALLCTNKQRSQSVRLRPISCA
Download sequence
Identical sequences B4M6J6
FBpp0225203 7244.FBpp0225203 XP_002056160.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]