SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225239 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225239
Domain Number 1 Region: 98-156
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000115
Family Tachycitin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225239   Gene: FBgn0198093   Transcript: FBtr0226747
Sequence length 191
Comment type=protein; loc=scaffold_12855:join(4382921..4382963,4383175..4383369,4384278..4384388,4384467..4384693); ID=FBpp0225239; name=Dvir\GJ10822-PA; parent=FBgn0198093,FBtr0226747; dbxref=FlyBase:FBpp0225239,FlyBase_Annotation_IDs:GJ10822-PA,GB_protein:EDW59339,REFSEQ:XP_002056227,FlyMine:FBpp0225239; MD5=508d523c89beab527c3e9a6f1b537803; length=191; release=r1.2; species=Dvir;
Sequence
MLHNGQQPKRVKIGDCRETERSKRTKRPRAPEPVNFEPEPQQDLENEESGSQEKDLPEIP
DNFLSPSVREYLELGKSIPGRPGVDYPILSAVPYTNFYCDEQSYPGFFADMETRCQGWHY
CDIDGRQASFLCPNGTQFSQAVFVCDWWFNVRCDLSPRLYAINARLYQRPKVNPTRPHRI
ITKQLVEDIFT
Download sequence
Identical sequences FBpp0225239 7244.FBpp0225239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]