SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0225293 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225293
Domain Number 1 Region: 284-383
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.49e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00088
Further Details:      
 
Domain Number 2 Region: 97-151,178-241
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.37e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.051
Further Details:      
 
Domain Number 3 Region: 15-98
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000694
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225293   Gene: FBgn0198144   Transcript: FBtr0226801
Sequence length 649
Comment type=protein; loc=scaffold_12855:5306266..5308215; ID=FBpp0225293; name=Dvir\GJ10876-PA; parent=FBgn0198144,FBtr0226801; dbxref=FlyBase:FBpp0225293,FlyBase_Annotation_IDs:GJ10876-PA,GB_protein:EDW59414,REFSEQ:XP_002056302,FlyMine:FBpp0225293; MD5=634bc1149d6dd6cb679cd8822c8d8d0b; length=649; release=r1.2; species=Dvir;
Sequence
MDDANIQDKERFASRENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAV
AHMKALRGTGNTSSDGTYKPSFLTDQELKHLILEAADGFLFVVSCDSGRVIYVSDSVTPV
LNYTQSDWYGTSLYEHIHPDDRDKIREQLSTQESQNAGRILDLKSGTVKKEGHQSSMRLS
MGARRGFICRMRVGNVNPDAMVSGHLNRLKQRNSLGPSRDGSNYAVVHCTGYIKNWPPTD
MFPNVHMERDVDDMASHCCLVAIGRLQVTSTAANDMTGSNNQSEFITRHALDGKFTFVDQ
RVLHILGYTPTELLGKICYDFFHPEDQSHMKESFDQVLKQKGQMFSLLYRARAKSSEFVW
LRTQAYAFLNPYTDEVEYIVCTNSSGKTLHGATPEQQQQQQQQQQQAEQQHVYVQAPGVD
YTLQPPRREITPTGGDGGIYQMHMQAPPPRPASAQNTPVAYSYDATHSPYGAAAGGGPSP
LAKLPKSGTSPTPNAWGARGMPGQQPQPTSTEAYPAYQQSSPARSPSGPTYTQLSAGNGQ
QQQQQQQQQQQQQQQQRQQQQQQAAAYQAGPAATPWDWQNAATHPAHPHPHPHPHAHHPH
AHAHPGAAVVPGAQQPQGQEFSDMLQMLDHTNTTTFEDLNINMFSTQFE
Download sequence
Identical sequences B4M453
7244.FBpp0225293 XP_002056302.1.90633 FBpp0225293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]